KEGG   Lactobacillus casei LOCK919: LOCK919_1981Help
Entry
LOCK919_1981      CDS       T02729                                 

Definition
(GenBank) Pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl00330  Arginine and proline metabolism
lcl01100  Metabolic pathways
lcl01110  Biosynthesis of secondary metabolites
lcl01130  Biosynthesis of antibiotics
lcl01230  Biosynthesis of amino acids
Module
lcl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LOCK919_1981
Enzymes [BR:lcl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     LOCK919_1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AGP68672
UniProt: A0A0K1MV07
LinkDB All DBs
Position
complement(1943036..1943833)
Genome map
AA seq 265 aa AA seqDB search
MTIGFIGAGNMARAIITGLLAKNAVTPEEIVLHGGQPIHYEPYAAKIGAKAVASNQAVAD
TADIVFLAVAPKLGVPILKTIGPTLKQRQVPIVSMLTGVSLATLEDALGSQDQPVLRIMP
NVNVAINAGMTAYAANDSVAGQLDGLLDLLNVLGKTMALPEDQFSTFVALAGSSPAFVYL
FIDSLSRAGVKYGLTKKQATAIAAQAVMGSAQNVLASEQSPFDLIDQVSSPGGTTVAGLL
AMEQAGLMSAVIKGVDATIAKDRQG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacaattggatttattggtgccggcaatatggcacgggcgatcatcactggtttgtta
gctaaaaatgcggtcacgcctgaggaaattgttctgcatggcgggcaaccgattcactat
gaaccgtatgccgccaaaattggcgccaaagcggtcgcgagcaatcaggcagttgcagac
actgccgatatcgttttcctagctgttgcccccaaacttggtgtgccgattctaaagaca
atcgggccaacgctcaaacaacggcaggtaccgattgtttcgatgcttaccggtgtttca
ctggcgacccttgaagatgcccttggcagtcaagatcaaccggtcctgcgaattatgcct
aatgtgaatgtggctatcaacgcggggatgacggcttacgctgctaatgatagtgttgcg
ggtcaattagatggcttactggacttattgaacgtcttaggtaaaactatggcgttacct
gaggatcaattttcgacatttgtcgcgttggcagggtcatcaccagcttttgtttactta
ttcatcgatagcctatcgcgagctggcgttaagtatgggttaactaaaaaacaggcaaca
gccattgctgctcaagcagtgatggggagtgcccaaaatgttttggccagcgagcaatcg
ccatttgatctgattgatcaagtctcaagcccaggtggtacaacagtagctggcttgttg
gcgatggagcaagcagggctcatgtctgccgttatcaagggagtggacgcaaccattgct
aaggatcgtcaaggataa

DBGET integrated database retrieval system