KEGG   Lactobacillus casei LOCK919: LOCK919_2379Help
Entry
LOCK919_2379      CDS       T02729                                 

Definition
(GenBank) Transport ATP-binding protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
lcl  Lactobacillus casei LOCK919
Pathway
lcl02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lcl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LOCK919_2379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcl02000]
    LOCK919_2379
Transporters [BR:lcl02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    LOCK919_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_16 RsgA_GTPase T2SSE NACHT AAA_33 AAA_35 AAA_29 AAA_24 AAA_22 NTPase_1 TctB MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AGP69061
UniProt: S4ZP67
LinkDB All DBs
Position
complement(2349014..2350741)
Genome map
AA seq 575 aa AA seqDB search
MHWLKNEHWVRPDLKRYRGLLVWSLILGVMTFVFAGALMFTSGFLIDKSATKPLFAAIYV
TVVLTRAFGIGRPVFQYIERLTSHNWVLRITSHMRRKLYKVLETDAAFVSEHHQTGDILG
LLADDIGHIQNLYLRMIFPTVVGAGLTVIATLLLGWFNWGFALWIMLLLLFQVLILPWWG
LVVERFRKAEQKQLNHDAYVSLTDSVLGLSDWVITHREKDFMSQSLAAPKKLAASTVKSK
RFQWRRDFVGQLLFVLIVISMLIWTNLEWTGNQASANWVGAFVLVVFPLDQAFSGIAQGV
GEWPTYRDAIRHLNDLQPVTRQLPQQQAVPTQFKEMTLQHLSFQYTPKDPELITDIDLTV
HSGEKIAILGPSGMGKTTLLQLVLGDLTPTTGNVLVDGQDVLTYQQHRTNLFAVLDQSPF
LFNTSIVNNVRLGNEQASDADVAAALKAVKLDQLVAQLPNGINSSVEEAGFGFSSGERQR
LSLARILLQDAPIVLLDEPTVGLDPITEQALLETMFTVLQGKTILWVTHHLQGVNQTDRV
IFLEDGRLTMNDTPSHLAKNDERYQNLYALDAGLR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcattggttgaaaaatgagcactgggttcgcccagacttgaaacgctatcgcggctta
ctcgtctggtcgttaattctgggggttatgacctttgtctttgctggtgccttgatgttc
acgtcaggttttctgattgataaaagtgccacgaagccattgtttgcagctatttatgtc
acggttgtcttgacccgcgcttttgggattgggcgaccggtgtttcaatacattgaacgg
ttgaccagtcacaactgggtgttgcgcattactagccacatgcggcgaaaattgtacaaa
gtgttggaaactgatgctgcctttgtgtccgaacatcatcaaaccggcgatattctaggc
ttgctcgccgatgacattggtcacattcagaatctatacttgcggatgattttcccaact
gtggtcggcgctggtctaacggttattgccactttgttgctaggctggttcaactggggc
tttgcactatggattatgttgttgctgttgtttcaagtattgattctgccttggtgggga
ctggtagttgagcgttttcgaaaggcagaacaaaagcaattgaatcatgatgcctatgtc
tcattgacggattcagtgctcggtttgtccgattgggttattactcatcgtgaaaaggat
tttatgtctcaaagtctggcggcccctaaaaaattagccgcatcgacggtgaagtccaag
cgatttcaatggcgccgagactttgtcggccaactgctgtttgtcttaattgtcattagt
atgttgatctggacaaaccttgagtggaccggtaatcaagcgagtgctaactgggttggg
gcgtttgtactggttgttttcccactcgatcaggcgttctccggcatcgcacaaggggtt
ggcgaatggccgacataccgagatgcgattcgtcatctcaacgatttgcagccggtcacg
cgacaattaccgcaacaacaagcagtaccgactcagttcaaagagatgacattgcagcat
ctcagttttcaatacacgccaaaagatcctgaattgattaccgatattgatctaaccgtt
cacagcggcgagaaaattgcgattctcggacctagtggcatgggcaaaaccacgttgttg
caacttgtacttggtgacctaacgccgacaactggaaacgtgttggtcgacggtcaagat
gtcctgacttatcagcagcatcgcaccaatctttttgcggtgttggatcaaagtccgttt
ttattcaacacgtcgattgtcaacaatgtccgcttaggcaatgagcaggccagcgatgct
gatgttgccgctgctcttaaggcagtcaagctagaccagctcgtagcccaattgccgaat
ggtattaacagcagtgtcgaggaagcaggtttcggcttttcaagtggtgaacggcaacgt
ttgtcgctagctcgaattcttttacaggatgcgccgattgtgctgttggatgaaccgaca
gtcggccttgatccaattacggaacaggctttgctggagacgatgttcacagtattgcaa
ggcaaaaccattctttgggtgacgcatcatttgcaaggcgtcaatcaaactgatcgcgtc
atttttcttgaagatggccgtttgacgatgaatgatacccctagtcacttggctaagaac
gacgagcggtatcagaacttgtatgctttggatgcggggctacggtga

DBGET integrated database retrieval system