KEGG   Lactobacillus casei LOCK919: LOCK919_2409Help
Entry
LOCK919_2409      CDS       T02729                                 

Definition
(GenBank) Permeases of the major facilitator superfamily
Organism
lcl  Lactobacillus casei LOCK919
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-ProteinID: AGP69089
UniProt: A0A1S2APF4
LinkDB All DBs
Position
2375086..2376543
Genome map
AA seq 485 aa AA seqDB search
MLTTTDVNGHPYNRLLLVITLLIGTFTTFLTQTILTTAYPTLMADFHISASAVQWLTTGF
MLIMGIMIPVSAWLLDKFNVKYLYLTAMTIFFLGSLICWLAPDFQVLLAGRLTQAIGVGM
SMPTFQTVMFTIFPPGKRGSAMGLAGIVIGLAPAIGPTLSGWILLNHTWRALFAVIMPIA
AGVVLLAIYSMRKVLPTSNPKIDIPSIIASTLGFGGLLYGFSTVGDAGWTDFQVLISLAI
GIIFVALFCVRQLRLETPLLELRVFKSRTYTLSVILTAVAFMSMVGVEMVLPMYIQTIRG
ESAFHSGMILFPGAIMMGIMSPITGRIFDKIGAKRLAVAGLFLLVAGSLPLVTLTANTPI
IYITTIYTVRMFGITMVTMPVTTAGMNALPTHLINHGTAVNNTVRQVAASIGTAILVSVL
SVVTKDATPAASGRLLDPIHYTNAMNNAVIAGYRAAFAVSLVMAALGLVLSLFLKTDVID
RRDAS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ttgttgacaacaacagacgttaatggtcatccatataatcgcttgctgcttgtgattacc
ttgttgatcggtacttttacaacattcttgacgcaaacgattttgaccacggcttacccg
acgctgatggcggattttcacatcagcgcgagtgcagtccaatggctgaccactggcttc
atgctgattatgggtattatgatcccggtttccgcatggctgctggataaattcaatgtt
aagtatctctacttaacagctatgacaatctttttccttggttccttgatttgttggtta
gcaccagattttcaagttctgctggctggtcggctcacgcaggcgattggcgttggtatg
tcaatgccgactttccaaacagtcatgttcacgattttcccacctggcaaacgtggtagt
gccatgggcctagctgggattgttattggcctagctcctgccatcggcccgacgctttct
ggttggattctgcttaatcatacttggcgggctttatttgccgttattatgccaattgct
gctggggtcgtgctgctggccatctatagcatgcgaaaagttttgccgacctcgaatcca
aaaattgatattccttccattattgcttcgactttgggttttggcggcttgctttatggc
ttctccacagttggtgatgctggttggaccgatttccaagtactgattagcttagccatc
ggcattattttcgttgccttattctgcgtgcgccagttacgcctcgaaacgcctctgcta
gaactgcgcgttttcaaatcacgcacgtatacattgagcgtcattttaacagcggtggcg
tttatgtcgatggttggtgtagaaatggtcttgccaatgtacatccaaacgatccgtggt
gaatctgcctttcactctgggatgatcctttttcccggagccatcatgatggggattatg
agtccaattaccggccggattttcgacaaaattggggccaagcggctggctgttgccggt
ctgttcttgctagttgccggatcgctgccgctggtcaccctaactgctaacacgccgatt
atctatattacgaccatttacacagtgcgcatgttcggcattaccatggtcacgatgccg
gtcaccactgctggtatgaacgccttgccaacacacctgatcaatcacgggacggcggtc
aataacacggttcggcaagtcgccgcctcaattggcaccgcaatactggtgtcagtatta
tcagtagtcactaaagatgcaacgccagccgctagtggtcgactgcttgacccgatccat
tacaccaacgctatgaacaatgcagtcattgccggttatcgcgcggcttttgccgtctca
ctagtcatggcagcgcttggtctcgttctcagcttatttttgaaaacagacgtcattgat
cggagggacgcctcatga

DBGET integrated database retrieval system