KEGG   Latimeria chalumnae (coelacanth): 102345199
Entry
102345199         CDS       T02913                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102345199
   04115 p53 signaling pathway
    102345199
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102345199
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102345199
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Cytochrome-c551
Other DBs
NCBI-GeneID: 102345199
NCBI-ProteinID: XP_006013675
Ensembl: ENSLACG00000001149
UniProt: M3XHZ3
LinkDB
Position
Un
AA seq 104 aa
MCDIEKGKKVFVQKCSQCHTVEKGGKHKTGPNLNGLFGRKTGQAEGFSYTEANKNKGIVW
DKDTLMEYLENPKKYIPGTKMIFAGIKKTSERRVLIAYLEDATK
NT seq 315 nt   +upstreamnt  +downstreamnt
atgtgtgatatagaaaaaggaaagaaggtatttgttcagaagtgttcacagtgccacaca
gttgaaaagggaggaaagcacaagactggccccaatttgaatggcctgtttggacggaag
actggtcaagctgaaggcttttcttacactgaagccaacaagaataaaggaatcgtctgg
gataaggatactctaatggaatacttggaaaatcccaagaagtatattccaggaacaaaa
atgatctttgctggtattaagaagacgagtgaaagacgagtcttgatagcttacctggaa
gatgccactaagtaa

KEGG   Latimeria chalumnae (coelacanth): 102363280
Entry
102363280         CDS       T02913                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102363280
   04115 p53 signaling pathway
    102363280
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102363280
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102363280
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Other DBs
NCBI-GeneID: 102363280
NCBI-ProteinID: XP_006012350
Ensembl: ENSLACG00000005156
UniProt: H3A836
LinkDB
Position
Un
AA seq 104 aa
MGDVEKGKKMFVQKCAQCHTVEKGGKHKTGPNLWGLIGRKTGQAEGFSYTDANKSKGIVW
NEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgatgtagagaagggcaagaaaatgtttgttcagaaatgtgcccagtgccataca
gttgaaaagggtggtaaacacaagactggcccaaacctttggggcctgattggtcgtaag
acaggacaggcagaaggcttctcttacaccgatgcaaataagagtaaaggaattgtctgg
aatgaggatacattaatggaatatctggagaatccaaagaaatatattcctggaacaaaa
atgatttttgctggcattaaaaagaagaatgaacgtgcagatcttattgcctacttgaaa
tcagcaacctcttaa

DBGET integrated database retrieval system