KEGG   Latimeria chalumnae (coelacanth): 102345227Help
Entry
102345227         CDS       T02913                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102345227
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcm01002]
    102345227
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102345227
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102345227
Peptidases [BR:lcm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102345227
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102345227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102345227
NCBI-ProteinID: XP_005999194
Ensembl: ENSLACG00000015343
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MKALVLFMLLGAAVADDDKIVGGYECPVSSKPFQVSLNAGYHFCGGSLINENWVVSAAHC
YMSPSRVVVRIGEHNIFSSEGTEQFIQAQKAIRHPRYSSYNLDNDIMLIKLSRPVEMNQR
VRPISLPRSCAPAGTMCQVSGWGDTFNGMPADLQCLDIPILTDRKCDNSYPGMITSNMFC
AGYLEGGKDSCQGDSGGPVECNGELQGVVSWGYGCAERNHPGVYTKVCNYNDWLISTISS
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctggtcctgtttatgctactgggagccgcagtggcagacgatgataagatt
gttggtggctatgagtgtcccgtcagctccaaaccctttcaggtgtctctaaatgctggt
tatcatttctgtggagggtccctcatcaatgagaactgggtagtttcagctgctcattgc
tacatgagccccagccgtgtggttgttcgtattggagaacataacatcttcagttcagaa
ggaacagaacaattcattcaagcccaaaaagcaattaggcatccgaggtacagctcttac
aatttagacaatgacatcatgctgatcaaactctccagacctgttgaaatgaaccagaga
gtgcggccaatcagccttcctagaagttgtgctcctgcaggaaccatgtgccaagtgtct
ggatggggtgacaccttcaatggaatgcccgctgatctacagtgcctggatatcccaatc
ttgacagatcgtaagtgtgataactcttacccaggaatgatcacttcaaatatgttctgt
gctgggtacctggagggtggaaaagactcttgccagggtgactctggcggccctgtcgag
tgcaatggagaactgcaaggagttgtttcttggggatacggttgtgcagagaggaaccac
ccaggtgtttataccaaagtctgtaactacaatgattggctcatctccaccatctctagc
aactaa

DBGET integrated database retrieval system