KEGG   Latimeria chalumnae (coelacanth): 102345323
Entry
102345323         CDS       T02913                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04141  Protein processing in endoplasmic reticulum
lcm04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102345323 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102345323 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcm03000]
    102345323 (ATF6B)
Transcription factors [BR:lcm03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102345323 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC CCDC-167 YabA
Other DBs
NCBI-GeneID: 102345323
NCBI-ProteinID: XP_014347021
LinkDB
Position
Un
AA seq 663 aa
MEADLPANLFNCMESEHNMFETDLDLCLDAAPSDAAWTSVNEDIFADLQVKSEPLSPTPS
HCSESSLSSASETPYLQQITNLDAAVTAVKVEDPPTPPYMFGDVLSPPLNNVRINLVASP
DCTLSPVKQRSPAKGAADLKTDPIFISKPAIQPKPVVVTKTTTVPVPQSAGPAKTIILQS
VQAGLSGTQTQPLPIPAPSLVLSQNDLLRLPMPGLIKLETGGLNGVTAAPARHAGGNSAG
IGSVKTPTKPIIPAPTPLAAAVASEIDMKRLKRQQRMIKNRESACQSRKKKKEYLQGLES
RLQEVLSENESLRRENTLLKKKLDGVLSENQELRFGSGNRKTMCVMVVLLFIVFNFGPVS
LSERKLEPFPQPGQERVRPQTGRQLLEFKDSLLKENGAVLATEEEQEAVMRTGEFRFRNV
TASFTDVKDLVLRDIDHFFSTSDCRQFNKTESLRLADELRGWVHRHQIERKKSNRKPTRP
KKLKVHQKAQKKMLNLSRYVAVANQRNMDRDASSQLQLYQRPEQSYYDFMDAIDRREDTF
YVVSFRRDHLLLPAISHNKTTRPKMSLVMPAMALNESLYNSSRGYEVMMQIDCEVMDTRM
IQIKSSTVPTFLRQRQDNRTAPAEERHDSGRADLRGIRPHRVPLPPGHSKRGPSLYFTDS
DGV
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggaggcggacctgcccgcgaacctcttcaactgtatggagagcgaacacaacatgttt
gagactgatctggatttatgtctggatgccgctccttccgacgctgcctggacctcagtg
aacgaagacatctttgcagacctgcaggtgaagtctgagcccctctcgccgactccgtct
cattgctccgagtcctctctgtcctctgcctccgagacaccgtacctacagcagattaca
aacctggatgcggcggtcacggctgtgaaggtggaggaccctcccacgcccccgtacatg
tttggagacgtcctgtctcctccgctcaacaacgtccggataaacctggtcgccagtccg
gactgcaccctgtcccctgtcaaacagagatccccagccaagggagccgcggacctgaaa
acggaccccatcttcatcagcaagccagcgatccagcccaaacccgtggtggtgacgaag
acgacgacggtccccgtgccccagagtgcgggccctgccaagaccatcatcctgcagtcc
gtgcaggcgggcctctcgggtacacagacccagccgctgcccatcccagctccgtccctg
gttttatcccagaatgacttgctacggttgcccatgccgggtctgatcaagctggagacc
ggcgggttgaacggggtaacggccgcccccgccaggcacgcgggtgggaacagtgccggc
atcgggagcgtgaaaacccccaccaaacccatcatccctgcaccgacgccactagcggcc
gccgtggcttcagagatcgatatgaagcggctgaagcgtcagcagcggatgatcaagaac
cgggagtcggcctgccagtcccgcaagaagaaaaaggagtacctgcaggggctggagagc
agactgcaggaggtgctgtccgagaacgagtccctacgccgcgagaacaccctcctcaag
aagaaactggacggcgtcctctccgagaaccaggagctgcgattcggatctgggaacagg
aaaaccatgtgcgtgatggtggttctgctctttattgtgttcaacttcgggcctgtgagc
ctcagcgagcggaagttggaaccttttccccagccgggacaggagagagtgcgtccgcaa
actgggcgccagctgctggaattcaaagatagtctcctgaaggagaacggcgccgtgctg
gcgacggaggaggagcaagaagcagtgatgcggacgggagaattccgcttcaggaacgtg
acggcctcattcacggacgtgaaggatcttgtcctgcgagatatcgatcacttcttctcc
acgtccgactgccggcagttcaacaaaaccgagtccctcaggctggcggacgagctgagg
ggctgggtgcaccggcaccagatcgaaaggaaaaaatccaacagaaagccaaccagacca
aagaagctcaaagtgcaccagaaagctcagaagaagatgctgaatttgtctcgctacgtg
gctgtggcaaatcagagaaacatggacagggatgcttccagccagctgcagctgtatcag
aggccggagcagagttactatgacttcatggacgctatcgacagacgggaggacaccttc
tacgtcgtttcgttccgaagggaccacctgctgttacctgccattagccacaacaagacc
accagacccaagatgtccctggtgatgccagccatggcactgaatgagagtctctacaac
tcgtctcggggttatgaggtgatgatgcagatcgactgcgaggtgatggacacccggatg
atccaaatcaagagctccaccgtcccaaccttcctgcgccagcggcaggacaaccgcacc
gcccccgccgaggagcgccacgactccgggcgggccgacctccgcggcatccggccccac
cgcgtcccgctgccgccgggccactccaagcggggcccttccctctacttcactgacagc
gacggggtttag

DBGET integrated database retrieval system