KEGG   Latimeria chalumnae (coelacanth): 102345933Help
Entry
102345933         CDS       T02913                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00040  Pentose and glucuronate interconversions
lcm00051  Fructose and mannose metabolism
lcm01100  Metabolic pathways
Module
lcm_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102345933 (SORD)
   00051 Fructose and mannose metabolism
    102345933 (SORD)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     102345933 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C YdfZ ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 102345933
NCBI-ProteinID: XP_005995691
Ensembl: ENSLACG00000002327
UniProt: H2ZYY0
LinkDB All DBs
Position
Un
AA seq 356 aa AA seqDB search
MAREVCSNLAVVVHAAGDLRVEFRPVPEPGPNEVLLRIHSVGICGSDVHYWLHGRIGDFV
VKKPMVLGHEASGTVVKLGPAVTHLKPGDRVAIEPGVPRETDEFCKTGRYNLSPTIFFCA
TPPDDGNLCRYYVHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSQVLICGA
GPIGLVSLIVAKGMGASQVVVTDLSASRLEKAKELGADFTLEITNETSEKLAQKVSDLLG
CMPEITMECTGAESSIQTGIYATRSGGTLVLIGLGPAMLKVPIVNALVREVDIRGIFRYC
NTWPVAIAMLSSKRVNVKPLVTHRFPLEQALEAFETTRKGLGVKVMLKCDENDREP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggaagtttgcagtaacctggctgtggtggtgcatgcagcgggggacctgaga
gtggagtttcgcccagttcctgagccaggtccaaatgaggtgttgctgcgaatacattcg
gttgggatctgtggttctgatgtccactactggctgcatggccggatcggagattttgtt
gtaaaaaagcccatggttttgggacacgaggcttcaggaactgtggtgaaattggggcct
gctgtaacccacctgaaaccaggtgatcgagttgctattgaacctggtgtgccacgagaa
actgatgagttttgtaaaactggtcgctacaacttgtctcctactattttcttctgtgcc
acccctcctgacgatggaaacctgtgccgatactatgttcataatgccaacttctgctat
aaacttcctgacaacgttacttttgaggaaggtgccctgattgaacccctttctgttgga
atccatgcgtgtcgaagagcaggggtcaccctggggagccaggtgcttatctgtggagca
gggccgattgggctagtttctctgattgttgccaaagggatgggagcttcccaagtagta
gtaactgacctctctgcttctcgactggagaaagccaaagaattgggagcagattttact
ctggaaatcaccaacgagacatctgagaaacttgcacagaaagtcagtgacttgctgggc
tgcatgccggagattacaatggagtgcactggtgcagagtccagtattcagactgggatt
tatgctacacgttctggtgggactctggttttgatcgggctgggtcctgcgatgttgaag
gttcctattgtgaatgcactggttcgggaggtggatatccgagggattttccgatattgt
aacacgtggcctgtggctatagccatgctctcttcaaagagagtgaacgtcaagcctcta
gtcacacaccgtttcccactcgagcaggcccttgaagcctttgaaacaacaaggaaaggg
ctgggagtcaaagtgatgctgaagtgcgatgagaacgaccgtgagccatga

DBGET integrated database retrieval system