KEGG   Latimeria chalumnae (coelacanth): 102346326Help
Entry
102346326         CDS       T02913                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00430  Taurine and hypotaurine metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    102346326 (CSAD)
Enzymes [BR:lcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     102346326 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Aminotran_1_2 DUF739
Motif
Other DBs
NCBI-GeneID: 102346326
NCBI-ProteinID: XP_005986193
Ensembl: ENSLACG00000016708
LinkDB All DBs
Position
Un
AA seq 520 aa AA seqDB search
MNAHQGEKRRDPVVSRTCPLEKSDPEDRLSRVSPNMFWQDNHAGEKFVEDAFQVILEEAI
RKGMDVNEKVCEWKEPSELREILDLELTEEGEPPEKLLGRCRDVIRYSVKTSHPRFFNQL
FAGLDHHSLVGRFITEAMNESQYTYEIAPVFVLMEEVILKKLRELVGWKTGDGIFCPGGS
ISNMYGMNLARYHLYPDVKQKGLWGIPRLVMFTSEEGHYSVSKSAALLGIGTDNIYKVKA
DAKGKMIPEELKKQIEHAKSQGAVPFFVCATSGTTVLGAFDPLNEIADLCEKHQLWFHVD
AAWGGGVLLSRKRRHLLSGIERADSVAWNPHKLMMAGLQCSAFLMKDDSGLLKKCHSASA
TYLFQQDKFYDLRYDTGDKSIQCGRKVDCLKLWLMWKALGTRGLEERVDQAFSNTSYLVN
EMKKRKGFQLFLEPEFVNLCFWYIPPSLQGQEMNEDFQKKLNKVAPVIKERMVKKGTMMV
GYQPHGKHVNFFRQVILNPRTSKEDLDFFLDEIERLGEDL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctcaccaaggggaaaagagaagagacccagtggtctctcggacctgtcctctt
gagaagtctgacccagaagatagactctccagagtctcccccaacatgttctggcaggat
aaccatgctggggagaagtttgtggaggatgcattccaggtcatcttggaagaggccatc
cggaagggaatggatgtcaatgaaaaggtgtgtgaatggaaggagccgagtgagctcagg
gagatcctagacttggagctgaccgaggagggggagccccctgaaaagttgctgggacgc
tgtcgtgatgtcatccggtacagcgtcaaaacatcccatccacgttttttcaatcagctg
tttgctggcctggaccatcattctctcgtcgggaggttcatcactgaagctatgaatgaa
agccagtacacttatgagattgcccctgtgtttgtcctgatggaagaggtgattttgaaa
aaactgagggaactagtaggctggaagacaggggatggaatattctgtccaggaggatcc
atctccaatatgtatggaatgaacctggccagataccacctctaccctgatgtcaaacag
aagggattgtggggaatccctaggctggtaatgttcacgtcagaagagggtcactactcc
gttagcaaatctgccgctttgctgggaattggaacagataatatctacaaggttaaagcg
gatgcaaaggggaaaatgattcctgaagaactcaaaaagcaaattgagcatgcaaaatct
cagggtgcagttcctttctttgtttgcgccacctctggtacaactgttttgggtgccttt
gacccactgaatgaaattgcggacttgtgtgagaagcatcagctttggttccatgtggat
gcagcatggggcggaggggtgctgttatctagaaaacgcagacaccttctgagtggaatt
gagagggcagactcagtggcgtggaacccgcacaagttaatgatggctggtcttcaatgc
tctgctttcctcatgaaggatgattcaggcttgctgaagaagtgccattcggccagcgcc
acctatctgttccagcaggataaattttatgacctccgctatgacaccggtgacaagtca
attcagtgtgggcgaaaggtggactgcttaaagctgtggctgatgtggaaggctcttggg
acacgggggctggaggaaagggtggatcaagctttctcaaataccagctatctggtgaac
gaaatgaagaaaaggaaaggcttccagctctttctggagccggagtttgtgaatttatgc
ttctggtatataccaccaagcctgcaaggccaggagatgaatgaggatttccagaagaag
ctgaacaaggttgctccagtgattaaagagcgcatggtgaagaaaggtaccatgatggtt
ggttaccagccgcatggcaagcatgtcaactttttcagacaagtcattctcaaccctcgg
acttccaaggaggacctggattttttccttgatgagatagagcgactgggagaggacctg
tag

DBGET integrated database retrieval system