KEGG   Latimeria chalumnae (coelacanth): 102346372Help
Entry
102346372         CDS       T02913                                 

Gene name
GADL1
Definition
(RefSeq) glutamate decarboxylase like 1
  KO
K18966  sulfinoalanine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.29 4.1.1.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00410  beta-Alanine metabolism
lcm00430  Taurine and hypotaurine metabolism
lcm00770  Pantothenate and CoA biosynthesis
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102346372 (GADL1)
   00430 Taurine and hypotaurine metabolism
    102346372 (GADL1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    102346372 (GADL1)
Enzymes [BR:lcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     102346372 (GADL1)
    4.1.1.29  sulfinoalanine decarboxylase
     102346372 (GADL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 102346372
NCBI-ProteinID: XP_005993764
Ensembl: ENSLACG00000001032
UniProt: M3XKM7
LinkDB All DBs
Position
Un
AA seq 519 aa AA seqDB search
MMSTIICNGAQTVAQNKEQLEKKNAILVDGVILNGPIIDAKAGQQFIQEAFPIIMEEAIR
KGTDVNEKVCEWQPPAQLKKILDLELRDVGENHQRLLQRCQDVIRYSVKTSHPRFYNQLY
AGMDPYSLVARFVTEAVNPSVYTYEVSPVFVLMEEAVLKKMIEHVGWKEGDGIFSPGGSV
SNMYAVNVARYKFCPDIKEKGLSGMPRLVMFTSEECHYSVKKAAAFLGIGTQNVYVVKAD
DRGKMIPEELEKQIEQAKKEGALPFLVSATAGTTVLGAFDPLDKVAGICERHGLWFHVDA
AWGGSALMSRKHRHILQGIHRADSVAWNPHKMLMAGIQCCAFLVKGNTGLLKECHSACAS
YLFQQDKFYDVEYDIGDKSIQCSRRADAFKFWLMWKAIGTRGLEERVNRAFALARYLADE
IKKREEFRLILEPEYASICFWYIPPSLRNMEEGPEFWQKLNKVAPIVKERMMKKGSMMVG
YQPHRGKVNFFRQIIISPQVSREDLDFLLNEIDNLGKDL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcactataatctgcaacggagcacagactgtggcccagaataaagagcagctt
gaaaagaagaatgctatcctggtggatggtgtcattctcaatggccctattattgatgca
aaagcaggtcagcaatttattcaagaggcatttcccatcattatggaagaggccataagg
aaaggcactgatgtcaatgaaaaggtctgtgagtggcaacctccagcccagttgaagaaa
attcttgacctagaacttagggatgtaggggagaatcatcaaagactattacaacggtgc
caggatgttatacggtatagtgtcaaaacaagtcatccaaggttctacaaccaattgtat
gctggtatggatccctattctttggttgctcgctttgtaacagaagctgtaaaccccagt
gtttatacctatgaagtgtcgccagtgtttgtgttaatggaagaagctgttttgaagaag
atgattgaacacgtaggatggaaagaaggagatggcattttcagtccaggaggctctgtt
tccaatatgtatgctgtgaatgtagccagatacaagttctgtcctgatattaaagagaag
ggactttcaggaatgccaagacttgtcatgttcacatcggaagagtgtcactactcagtg
aagaaagctgctgcctttcttggcattggcacacagaatgtgtacgttgtcaaagctgat
gacagaggtaagatgatacctgaggagctggagaaacaaattgaacaagccaagaaagag
ggggctctaccattccttgttagtgccactgctgggaccaccgtattgggagcttttgat
cccctggataaggtagcaggtatctgtgaaagacacgggctctggtttcatgtggatgca
gcctggggtggtagtgcactgatgtccagaaaacatcgccatattctgcagggcatccac
agggcggactctgtagcctggaatccacacaagatgctgatggctggtatccagtgctgt
gcatttctggtgaaaggcaacacgggtttgctgaaggaatgccactctgcctgtgcttcc
tatctgttccagcaagacaagttttatgatgtggagtatgacataggggacaagtcaatc
cagtgcagcagaagggcagatgctttcaaattctggctgatgtggaaagcaataggaacg
cgagggctggaggagagagtaaaccgggcatttgccttagcaagatatttagctgatgaa
ataaagaaaagggaagagttcagacttattttggagcctgagtacgccagcatctgcttt
tggtacatcccaccgagccttaggaatatggaggagggacctgaattctggcagaagctg
aacaaggttgctccaattgttaaagaacggatgatgaaaaaaggcagcatgatggtgggt
taccagcctcaccgcgggaaagtgaatttctttcgccagatcatcatcagccctcaggtc
agccgggaggacttggactttctgctcaatgagattgacaacctcgggaaggacttgtag

DBGET integrated database retrieval system