KEGG   Latimeria chalumnae (coelacanth): 102346817
Entry
102346817         CDS       T02913                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin G1
  KO
K10145  cyclin G1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102346817 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 102346817
NCBI-ProteinID: XP_005996913
Ensembl: ENSLACG00000010872
UniProt: H3ARS7
LinkDB
Position
Un
AA seq 296 aa
MIETLSTTSEAMKLMSQLSTLLEQEPKYQPKLCGLRIIESAHDNGLRMTARLRDFEVKDL
LSLTQFFGFCAETFCLTVNILDRFLAKMKVQPKHLACVGLSCFYLAVKAIEEERIVPLAS
DLIRISQCRFTVSDMTRMEKIILEKLCWKVKAVIALNFLRIYHTLILENSTSERKKMLNF
ERLEAQLKACHCRIVFSKAKASVLSLSILALEIQEQKLHELTEIVECLWQHSSATDRDLF
YWKELVAKCLAEYSTTKCFRPTSQKLKWIISGRTARQLKHSYYRIAHLPTIPEANA
NT seq 891 nt   +upstreamnt  +downstreamnt
atgattgaaacactttcaacaacctccgaagctatgaaactcatgagtcagttgagcacc
ttgctggagcaggagccaaagtatcagccaaaactctgtggattgaggataattgagtct
gctcatgacaacggcctccgaatgactgcaagactgagggactttgaagttaaagatctt
cttagcttaacgcagttcttcgggttttgtgctgagactttttgcctaacagtgaatata
ttggatagatttttggctaaaatgaaggttcaaccaaaacatctcgcttgtgttggatta
agctgcttctaccttgctgtgaaagcgatagaagaggagagaattgttcctctggcaagc
gatttaattaggataagccaatgccgattcacagtgtcggacatgactcgaatggagaag
attattttagagaaactatgctggaaagtaaaagctgttatagccttaaattttctgaga
atttatcacacccttattctcgagaattcaacttctgaaaggaaaaagatgcttaatttt
gagagacttgaagcccagcttaaagcatgccactgtagaatagtgttctccaaagcaaag
gcttccgtgctgtccttatctattctggcactggaaatccaagaacagaagctgcatgaa
ctgaccgagatagtagaatgtctttggcagcattccagcgctacagacagagatttattt
tattggaaagagttagtagccaagtgccttgcagaatactcaaccaccaagtgtttcaga
ccaactagtcaaaaactgaaatggatcatatctggacgaacagcacggcaattgaaacat
agctattaccgaattgcgcaccttccaactatccctgaagcgaatgcttaa

KEGG   Latimeria chalumnae (coelacanth): 102365710
Entry
102365710         CDS       T02913                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin G2
  KO
K10146  cyclin G2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102365710 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102365710 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 102365710
NCBI-ProteinID: XP_006010658
Ensembl: ENSLACG00000003053
UniProt: H3A1A3
LinkDB
Position
Un
AA seq 348 aa
MKDLGAQEHQSNEAYKLLKQLNHHLEQESKFQPKESGLNLIESTSENDNSICPRLRDAKV
EDLWSLTNFFGFSTGTFVLAVNLLDRFLAILKVKPKHLSCIGISCFHLAAKVTEEECNIP
SSLDIIRISQCKCTISDLQRMEKIISEKLHFEFEATTALTFLHLFHAIALTHTSERKDVL
NLEKLEVQLKACNCRLVFSKAKPSVLALSLLTLAVDSLKSIELFEIVLRVQKHSKISDAD
LLYWRELVSECLAEYSSAECCKPDHKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCCD
GSESEDSCEDMSCGEDSLGSSPSSDLEGSFFPEELRCKSKCQTFRFQS
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaaggatttgggagctcaggaacaccagagcaatgaagcctataaattattgaaacag
ctaaatcatcacttggagcaagagtcaaagtttcagcccaaagagagtggactaaacctg
attgagtcaacctcagagaatgacaacagtatttgtcctagattgagagatgctaaagtt
gaagatctctggagtttgacaaatttttttgggttcagtactggaacctttgttttggct
gtaaacctacttgacagattcttagcaattttaaaggtgaaacccaagcacttgtcctgc
attggaatcagctgctttcacttagctgctaaagtgacagaagaagaatgtaatataccg
tccagccttgacatcattcgcatcagccagtgtaaatgtactatctcggaccttcagagg
atggagaaaataatttcagaaaagctacactttgagtttgaagcgaccactgccttaacc
tttttgcacttgttccatgccatcgcacttactcacacttctgaaaggaaagatgttttg
aaccttgagaaacttgaagtacaactaaaagcttgcaactgtcgactagtattttccaaa
gcaaaaccatcagtattggccctgtctcttctgactctggcggtggactctttgaaatcc
attgaactgtttgaaattgtactgcgtgttcagaagcactctaaaatcagcgatgctgat
ttgctgtactggagagagttggtttccgagtgcttggcagagtattcttcagctgaatgc
tgtaagcctgaccataagaagctggtgtggatagtgtccaggcgcactgcccagaatctt
cacaacagttactacagtgttcctgaattaccaaccatcccagagggtggctgttgcgat
ggaagcgaaagtgaggattcttgtgaggacatgagctgtggagaagatagtctaggtagc
tccccatccagtgatttggaagggagcttcttccctgaagaacttcgatgcaagtccaag
tgccaaactttccgctttcagtcctaa

DBGET integrated database retrieval system