KEGG   Latimeria chalumnae (coelacanth): 102347366
Entry
102347366         CDS       T02913                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S-phase expressed 1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102347366 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 102347366
NCBI-ProteinID: XP_006002493
Ensembl: ENSLACG00000013471
UniProt: M3XJ14
LinkDB
Position
Un
AA seq 721 aa
MDLSREITLLTDEKFDFDISLSPGSSKEDDEVFIGPVGHKEKCVAVNVEMTHEKAHEHQI
VNLPNWIPLKGDQFVEIFKEAHLLALQLEKNGSTEQTKEKGQDKPRNGAVERFVEESKSK
LKMFQKGKETPGAIKREIVCIQRSPLKQIPPVTQLPLVVPVILDPASLQETDTGAASPVK
IKTPKKLSKSPQPQEKRSKSPLCKKSAPTINVNKIPSAKRQPVKAVHQPGGLFLSAEEPK
LGQKVLPSRRKHLSSAGSSEEVCSDSPSVTSDVSDSSFNSSTLGPGKRKLPAPYKLGLKK
PSTLKLPGAANRNATSVRRNTAASSSSSSISSLNSSFNSSMSVSPVGVNERKSGGLSTSK
NLQVASRNVKKTVPKLDSKLSNSSLAINPPSIPHKLTKSESAGKLLNAGNAARQTSASTV
HAHSSTSKGIQRIGSISQLNQPSLQHKAGSTVKGNSCPKPKAPIVPTTPSQLKIPKRSGV
PSPEPTPPKIMQPKRLLSCSAVGSGILAGTPLKQANGDLQNLGFSAKSVSVTPGARNISA
FPTPLKRHTSGIPGLTPRTLPKPLCTPRQTANHQVTSMSAKRISVASPKQVECAKTKAEF
SPSGTSSEQSPPLMVACTLSFTPEKIKLQASPQNEAIEHSSQSQQNNKGLLVDLEMNNGT
PAREVEDKPLIDFSSSPEFHESIDLLKPPVVGQLINLSSPLICLSPIANKENEVDSPLLK
F
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggatttatctagggaaattactctgctaactgacgaaaagtttgactttgacatctca
ttgtctcctgggagttcaaaagaagatgatgaagtctttattggaccagtggggcataag
gaaaaatgtgttgctgttaatgttgaaatgacgcatgaaaaggcacatgagcatcagatt
gtcaacttgccaaattggatccctcttaaaggagaccagtttgtggagattttcaaagaa
gctcacttactggcactgcagcttgaaaaaaatggcagtactgagcagaccaaagagaag
ggccaagataaacctagaaatggtgcagtagagcgatttgtggaagaatcaaaatccaaa
ctgaaaatgtttcagaaaggaaaagaaactccgggtgctatcaaaagagaaattgtgtgc
atacaacgcagtcctttgaagcaaattcctcctgtaacacagctgccattggtggtccct
gtgattctggatcctgccagtcttcaggaaactgatacaggtgctgccagccctgtgaaa
attaaaactcctaagaaactctccaagtctcctcagccacaggaaaaaaggagcaagagc
ccattatgcaaaaagagtgctcctacaataaatgtaaacaaaataccaagtgccaaacgt
caacctgttaaggcagttcatcaaccaggaggactttttctttcagctgaagagccaaag
ctaggtcaaaaggttcttccatctcgaaggaaacatcttagcagtgcaggctcatcagag
gaagtatgctctgacagcccaagtgttacttcagatgtgagtgattcatcctttaactct
agtacacttggacctggaaaaagaaaacttcctgctccgtacaagcttggtttaaaaaag
ccatctacactgaaactgcctggtgcagcaaaccgtaatgctacaagtgtaagaagaaac
actgctgcctcctcttcttcctcctctatatctagcttgaattccagtttcaactccagc
atgtcggtctctccagttggtgtaaatgaaagaaagagtggaggtctgagtacatcaaaa
aaccttcaagttgcatctagaaatgtcaagaaaacagtgcctaaactagatagcaagttg
tcaaattcttccctagctatcaaccctccaagcataccccacaagctaacaaaatctgaa
agtgctggtaaacttctgaatgctggaaatgcagccaggcaaacctctgcttcgacagta
catgctcactcttcaactagcaaaggaattcagagaatcggctccatatcacagctaaac
cagccatctctgcagcataaagctggaagtacagtgaaaggaaactcctgtccaaagcca
aaggcaccaattgttcctacaactccaagtcaactaaaaatccctaaacgatcgggtgta
ccttcaccagaacctaccccaccaaagataatgcagcctaaacgattgttgtcttgcagt
gcagttggaagtggtatccttgctggtactcctctcaaacaagcaaatggggaccttcag
aatcttgggtttagtgcaaagtctgtttcagtgacccctggtgcgagaaatatttctgcc
tttcccacaccactaaagcgtcatacttctgggattccaggattgacacctagaacatta
ccaaagcctttgtgtactccacggcaaactgcaaaccaccaggtcactagcatgtccgct
aaaagaattagtgtggctagtcccaaacaggtagagtgtgctaaaacaaaagctgaattc
agtccttctggtacttcctctgaacagtcaccacctctaatggttgcttgtactttgagc
ttcacccctgaaaaaataaagctccaggcatctcctcaaaatgaagcaattgagcattcc
agtcagagtcagcaaaataacaagggtttgcttgtggacctagaaatgaacaacggtact
ccagcaagggaagttgaagataaaccacttattgatttttcaagttcacctgagtttcat
gagagtattgatttgctgaagcctcctgttgtgggccagctgatcaatttgagttctccg
cttatttgtctaagtcctatcgcaaacaaggaaaatgaagtggattctcctctgctgaag
ttttaa

DBGET integrated database retrieval system