KEGG   Latimeria chalumnae (coelacanth): 102347668
Entry
102347668         CDS       T02913                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm03440  Homologous recombination
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102347668 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102347668 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102347668 (ATM)
   04210 Apoptosis
    102347668 (ATM)
   04115 p53 signaling pathway
    102347668 (ATM)
   04218 Cellular senescence
    102347668 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102347668 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102347668 (ATM)
   03400 DNA repair and recombination proteins [BR:lcm03400]
    102347668 (ATM)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102347668 (ATM)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102347668 (ATM)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102347668 (ATM)
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102347668 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT
Other DBs
NCBI-GeneID: 102347668
NCBI-ProteinID: XP_014351298
LinkDB
Position
Un
AA seq 3019 aa
MSLILHELLDCCRHLENDKATERKVNIQNSTRNTLNKYLQKFIQKETESLQAAKANVSAT
TQANRQKKLQEISSLVKYFIRCANKRRPRLKCQELLKHVMDIMQSSYSCAAYGTDYSSIL
LKDVLAVRKYWCEISQQQWEDLLTLYCRLYLKPSRDINRVLLARIIHTLIRGCCFQTDGL
ISRLLDFFSKAMQTARSEKVSVVLEHILAALNVLLHASASNCRIRVCKLGEEMLPTLLYI
WTQNRPQDCLKEEIIEFFRLQLRAHHPKGARTRETGAFASSWAKWQSLLYNLYDAVVNEI
NQIGSRGKYTSGSRHAAVKESLVAVTADICHQLFTQDASMLEMTQSAFATTQRESGQETP
SKRRRTELGWEVIRENLQRTQNDFDIIPWLQITAVLIANYPSSLPSHELAPVLNVLLQLL
SQQKRGERTPYALRCLREIAVCQSQKADLTLSQGQELPKLWAKIWAITVSIISSQQTETE
GYELLTAVIKGGLFVIDKEFWKLFSQSACKPSWPTVQCLSWALLKLHLPERLEVGMEYNA
LGEGVAFSSLREAIIKWLLSYQTEEDGEEHAELPPVICRDFPHLVLPQVLVSLTIKDCKA
GMDFFQHSLPTESIQCVPDRGDDGFSEVEELYLQTTFDKTPVCVSPPVNGTEKKSAASAI
IVNQALKEKLEHHLLAVTEQLLNNYSSESTPAECLIQCTGLLTGVLGCYCYTGVISEEDA
CNSNLFQKAKSVMQYAGEYVSLLKNKFGEESKLSSLRSLVTRCMSCLNNCTKGGKISSEL
FLQLLPSRFLNDLADLCKHLLTSSGKSSTSSEMDLMEDDPEESRMEGQGEVAMDLFEDDH
DRPSDLGDFSDTGEVGIGAKSSLSEEHLTKQDSLLLDTLRFLCGCVTAGQMCTVSFRPAD
IRRKLLLLIEENSLDTGKPLHLQLYLTLLKELPTKESVLPADSFFSLLKPLSNMCSLYRR
DQEICAAILTNLLPSIMALGQEGSDAEEMRDVRGQILTVVGAFWHISKEGKCTVLVRTAL
VKSMKALLETDPHSEWSVLTLRDEELSVSNAFPQFLADVHHQVRMLAAMSANRLFQAVES
HNSVERPKALPLKMQQKSFESVYMKVQAGMRVQSHVKPEEIPDEESNRKAALLMLISVVL
SSSPVCEKQALFAVCQSVRENGLSPQLVKKVLQNVSGSLGYRNLEDFMLSHLDYLVIEWL
RIQDYSLPTFPYVLLNYSSLEEFYRSCYNVLIPHLVARSDFEGVKSLAKEVKKDWQQVLT
DCFPKIMVNILPYFAYQGRSDQDVAQRRESASKVYDLLKEDSCLGKQQIDNLIHSNLPEI
VVELLMTLHESIDQEAREGAELVKYAGEMDPVPNPPHFPSHIIKATLDYISSCHKTKLKS
LVAILSKNPDSIQRILLAICKQAAEATNIYEKHRILIIYRFFVNLLLKEIQETLGGAWAF
ILRDVIYTLIHHVNSRPAHMDEVSSRSFSLCFDLLCFVCHTAVQFCGDALESHLHVIVGT
LTPLVSERLEIRQQVLNLLKYLVIDNQNNENLHQAIKLLDPFPDLPAFKDLRAIQQKLKF
IGGPFTLLEEINHFLSISYCDSLPLTRLEGLNELKKQLEQHKDQMKELIKECQEKPQKSV
LVKFVSSLLQLCKAAVNHPGELEVLEAVGGCLGEMGPIDFSTIALHYNKDMLYSRAVELF
EEKAFQWIFVIINLINNALTDQCIEVRAAAVTCLKSILATQPGVEFWDHHKNSGDPVLVY
LQLFRTTRKKFLEVPVVERPDPPENLDDGALWIPQDENHDSWLKTLTCALLDSGGVKSEV
LHLSRPMCEVKTDFCQTVLPYLIHDILLHDTSGSWRTLLSKHVQGFFSACYRVAPMSSRS
TTPANVDSETDSLIHGNIDKTSQSTMLAVVDYLRRQKRPNQGPQLGTAWDDNFWLDLNYL
EVAMAAQSCAAHFTAALYAEVYADKINLDNEEYRRGLTEGFYWDFLIEVYRSIGEPDSLY
GCGGGKMLQPLARIRTYEHEAMWHKALVTYDLETNLPASARQAGIIQALQNFGLSHILTT
YLKGLENENAEWCSDLREIRFQAAWKNMQWDYVPTVRDESTEPGYHESVFCAVHSLRDGE
FRVLHEGLKHARVKEIEKLCKGSLESVYSLYPALSRLQALGELDSLGHLYCRSDIEGIMK
EVSSKWQRHSQLLKDSDFTFQEPIMSLRTVIQEILLDRASEDSVRDGIRDILTEHLVELS
KLARAAGNTQLPERAISQIKQHNPNHYRVSQWQLEETQVFWDRNEKILALGILKKLIDKL
DCEVEYDETLIPMYAECLRLCGNWLAETCLESPGIIMQKYLERAVTEVRRHSGEQLQSGK
MKAFLSLARFSDAQYQSIVNYMKSSEFEHKQALLKNAKEEVGLMKEHRVQTTRYTVKVQR
ELELDERALDALKEDRKRFLCKAVENYINCLESGEEHDMWVFRLCSLWLENSTVFEVNKM
MKQGTEKIPSYKFLPLMYQLAARMGTKLRERLGFNEVLNNLISRATLDHPHHTLFIILAL
ANANKDDILQKPLGTKRSGLTKSAPKRISELDEERMEVARNIINKIRKHRPEMVKDIEKL
CDAYIFLANMDANQWKAQRKGIRIPEDQPITKIKDLHEVVIPTMEVKVDPSGKYENLVTV
SSFRAEFRLAGGVNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNA
ETRKRKLTIRRYKVVPLSQRSGVLEWCTGTVPIGEFLVNPEVGAHKRYRPKDWNSMQCRR
NMVDKQKSDFEAKYQIFMKVCQNFPPVFRYFFMEKFFDPAVWFEKRLAYTRSVATSSIVG
YIVGLGDRHVQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGIAGV
EGVFRRCCEKTMEVMRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQERTEEDADLNAT
LNSTMGGGGDDQECNRKSSNDAQNINKVAGRVLLRLQEKLKGVEEGTVLNVGGQVNLLIQ
QAMDPKNLSRLFPGWQPWV
NT seq 9060 nt   +upstreamnt  +downstreamnt
atgagccttatactacatgagcttctggattgctgtcgtcaccttgagaatgacaaggct
acagaaaggaaggtaaatattcagaacagcaccagaaatactttgaataagtacctccaa
aaattcatccagaaagaaactgaaagtcttcaagctgcaaaggccaatgtttctgccacg
acacaggccaacagacagaagaaactgcaggagatcagcagcttggttaaatacttcatc
agatgtgcaaataaaagaaggccccgtttaaagtgccaagagctcctgaaacatgttatg
gatattatgcaaagctcgtacagctgtgctgcttacggtaccgattacagcagcattctg
ctgaaggatgtcctggctgttagaaagtactggtgtgagatatcccagcaacagtgggaa
gatttgctgaccctgtattgcagactatatctaaagccttccagagatattaaccgggtc
cttttggctaggatcattcacacgttgatcaggggctgctgtttccagactgacggtctg
atatccaggcttttggattttttttccaaagcaatgcaaactgcaagatctgaaaaggtc
tccgtggttctggaacatattctggcagctttgaatgtattacttcatgcatctgcctca
aactgtcgcataagggtctgcaagctaggggaagagatgctgccaacactgttgtacatt
tggactcagaaccgaccccaagattgtttgaaggaagaaattattgaattttttcgcctg
cagcttcgtgcccatcatccaaagggagccaggactcgggaaactggtgcctttgcaagc
agctgggctaaatggcaaagcctcctgtacaacctgtacgatgctgtagtgaatgagata
aaccaaattggaagcagagggaaatacacgtctggatctcgccatgctgccgtgaaggaa
agtctggtggctgtaactgcagatatttgtcatcagctgtttacacaagatgcaagtatg
ctggagatgacccaatcagcctttgctaccacacaaagagaatcgggtcaagaaacgcca
agtaagcggagaagaactgaacttggatgggaagtgataagagaaaaccttcaaagaacc
cagaatgactttgatattataccatggttgcagattacagctgtcttgattgcaaattac
ccgtccagcctgcctagccatgaattggcgcctgttttgaatgtgctgttacagctcctc
tcgcagcagaagcgtggcgagaggaccccttatgcactaagatgtctgcgggagattgct
gtgtgccagagccagaaagcagacttgacactgtcccaagggcaggaactgccaaagctg
tgggccaaaatctgggccattacagtcagcattataagctcccagcaaacagagactgag
ggatatgaactgctgactgctgtcattaagggaggcttatttgtaatagacaaagagttc
tggaagttgttttcacagtcggcatgcaaaccatcttggcccacagttcagtgcctgtca
tgggcattgcttaaattacacctgcctgaacgcctggaagtgggaatggagtacaacgca
ttgggtgaaggcgttgcattcagctcattaagggaagcaataataaagtggcttctctcc
tatcaaactgaggaagatggtgaggaacatgcagagcttcctcctgtcatctgtagggac
tttcctcatcttgttcttccacaagttcttgttagcctcacgataaaagactgtaaagca
ggaatggattttttccaacactcacttcccactgagagcattcagtgtgtcccagataga
ggtgacgatggtttttcagaagttgaagagctatacctccagactacttttgacaaaacg
ccggtttgtgtcagcccgcctgttaatggtacagaaaagaaatctgctgcgtcagccatt
attgtgaatcaagccttgaaagaaaagttggagcatcatcttttggcagtaactgagcag
cttctcaataactattcttctgagtcgactcctgcagagtgtctgattcagtgcactggt
ctcttgactggtgttcttggatgttattgttacactggggtcatcagtgaggaggatgcg
tgtaactcaaacctattccagaaagctaagagtgttatgcagtatgctggggaatacgtg
tccttactgaagaataaattcggtgaggagtccaagctcagctcattgaggagtcttgtt
acacgctgcatgagctgcttaaataactgcaccaaggggggaaaaatatcctctgagctg
ttcctgcagctgctgccgtcaagatttttgaatgacctggcagatctttgtaaacattta
ctaaccagcagtgggaagtctagcacttcttctgaaatggatttgatggaagatgaccct
gaagaaagcaggatggaaggacaaggtgaagtggccatggacctgtttgaagatgaccac
gatagacccagtgatttaggagactttagtgacactggggaagttggcattggtgcaaag
agctctttgtcagaggaacacctaacaaagcaggactccctcctcctggacactctgagg
ttcctctgtggctgtgtaaccgcaggacagatgtgtacggtttctttcaggcctgcagat
attagaaggaagctgctactcttgatagaggagaattcattagacactggtaaacccctc
catttacaactgtacttgaccctgttgaaggagctcccaactaaagaaagtgttctacca
gcagacagcttcttttcacttttaaagcctctatctaatatgtgctccttgtatcgtcgg
gatcaggaaatctgtgcggccattttaacaaatctccttccatctataatggcccttggt
caggaaggaagtgatgctgaagaaatgagggacgtacggggacaaatcctaactgttgtt
ggagctttttggcacataagcaaggaaggcaaatgcacagttttagtccgaactgcttta
gtaaagagcatgaaagcacttctggagactgatccgcactcagagtggtcagttctgacc
ttacgagatgaagagttgtcggtgagcaacgcctttccacaattccttgcagatgttcat
caccaggtccgcatgctcgctgccatgtccgctaatagactttttcaagcagtggagtct
cacaattctgttgaaagaccaaaagcccttcctctgaagatgcagcagaaatcctttgag
agtgtatatatgaaagtccaagctggaatgagagtacagagtcatgtcaaaccagaggag
atcccagatgaagaatccaatcgaaaagctgccttgctgatgctaatatcggtggtcttg
tcctccagtcctgtgtgtgaaaaacaggccctatttgctgtttgccagtctgtcagggag
aatggcttatcccctcagcttgttaaaaaggttctccagaacgtctccgggtccttgggc
tatcggaacttggaagatttcatgctttcccacttggattaccttgtaattgagtggctg
aggattcaggactacagtttaccaacattcccttatgtactactgaattattcaagtctg
gaggagttttacaggtcctgctataatgttttgataccacatctggtggctagaagtgac
tttgaaggagtgaagtctcttgctaaggaggttaagaaggactggcaacaggtgctgact
gactgctttccaaagatcatggttaacatcctcccatactttgcctatcaaggtagaagt
gatcaagacgtggcacagcgaagagagagtgcatctaaagtctatgatcttcttaaggaa
gacagctgcttagggaagcagcaaattgataatctgatccacagtaacctgcctgagatt
gtggtggagctgctgatgactctgcatgagtctatagaccaagaggccagagaaggagct
gaactagtcaaatatgctggagaaatggatcctgttcccaatcctcctcattttccatca
cacatcatcaaggcaactttggattacatcagcagttgccataagacaaagttgaaaagc
cttgttgccatactttccaagaaccctgattctatccaaaggatccttcttgctatatgt
aaacaggcagctgaagccaccaatatctatgaaaaacacagaatccttataatctaccgt
ttctttgtgaacctgttgttgaaagaaatacaagaaacgttaggaggagcgtgggctttc
attttgcgagatgtcatttacaccttgatccatcatgtcaatagcaggcctgctcacatg
gatgaggtgtcttcacgtagcttttccctttgcttcgacctgctgtgcttcgtctgccat
actgcagtccagttctgtggggatgctttagaaagccaccttcacgtcattgttggcaca
ttgacacctttagtcagtgaacgactggagatccgacagcaggttctaaacttattgaag
tacttagtgatagataaccaaaataatgaaaacctgcatcaggccatcaaactcttggac
ccttttcctgaccttcctgcttttaaggatttgcgtgctattcagcaaaaacttaaattc
attggaggaccatttactcttttggaggagattaaccatttcctatctatcagttactgt
gattcactaccattaaccagacttgaagggctaaatgagcttaaaaaacagttagaacaa
cacaaggatcaaatgaaagagctgataaaggaatgccaagaaaaaccccagaaaagtgtt
ctggtaaagtttgtgtcgagtctgttacaactgtgcaaagctgctgttaatcacccgggt
gaactggaagttttagaggctgtaggaggctgccttggcgagatgggtccaattgatttt
tctaccatagccttacactataacaaggatatgctgtactccagagcagttgaattattt
gaggaaaaagcatttcagtggatatttgtcataataaatttgatcaacaatgcactaact
gatcagtgtattgaggttcgagctgctgctgtaacttgtttgaaaagcatcttagctacc
cagccaggcgtggaattttgggaccatcataaaaacagtggggatcctgtgctagtgtat
ctccagctttttagaacaacaaggaaaaagtttcttgaggtgccagtggttgaaagacct
gatccaccggaaaatttggacgatggagctttgtggattcctcaggatgaaaaccatgac
agttggttgaagacattgacttgtgcgttgctggacagtggtggggtgaaaagtgaagtt
cttcatttatcgaggccaatgtgtgaggtgaagacagatttttgccagacagtgcttccg
tatttgattcatgatatcctccttcatgacaccagtggatcatggagaacactgttatcc
aagcatgtccaagggtttttcagtgcttgttacagagttgcacccatgtcaagtagatca
actacacctgccaacgttgattcagagacggacagcttgattcatggaaatatagataaa
acatctcaaagtacgatgcttgctgttgttgattacttgagaagacagaagagacctaac
caaggaccacagttgggtactgcgtgggatgataacttctggctggacctgaattatttg
gaagttgctatggcagcacagtcttgtgctgctcactttacagctgccttatatgcagaa
gtctatgcagacaagataaacttggacaatgaagaatacagacgtggcctgacagaaggg
ttctactgggattttctgattgaagtatatcgaagcataggagaacccgacagtctttac
ggatgtggtggaggcaaaatgctacagccgcttgccagaatccgcacatatgagcatgaa
gcaatgtggcacaaggcccttgtaacatatgacctagagaccaatctccctgcatctgca
cgtcaggcagggataatacaggctttgcagaactttggacttagccacattctgacaacc
tatctcaagggcctggaaaatgagaatgcagagtggtgctcggatcttagggaaatacgc
ttccaggcagcctggaaaaacatgcagtgggattatgtgccgactgtcagggatgagtct
acagagccaggttaccatgaatctgtgttttgtgctgtacactcattacgagatggagag
ttccgtgtcctgcatgaaggcttaaagcatgcaagggtcaaggaaattgaaaaactctgc
aaaggaagcctggagtctgtgtattccctgtatccagccctcagcagactacaggcactt
ggggagttagacagcctgggacatctttactgcaggtctgatatagagggaatcatgaaa
gaagtctctagtaaatggcagagacattcgcagcttcttaaggacagcgacttcactttc
caagagccaatcatgtccttgaggacagtaattcaggagatccttcttgacagagcgagt
gaggactcggtcagggacggcatcagggacattctcactgaacatctcgtagagttatca
aaactagcacgagcagctggaaacacccagcttccggaaagagccatctctcaaataaag
caacacaacccaaatcactatagagtctcacaatggcagctagaagaaactcaggttttc
tgggatcgaaatgagaagattcttgcgctgggcatcctcaaaaagttgattgacaagttg
gattgtgaggttgagtatgatgaaactcttatccccatgtatgcagaatgtcttcgatta
tgtggcaattggttagcagaaacctgcttggaaagccctggcatcatcatgcagaaatat
ttagaaagggcggtgacagaggttagacgtcacagcggcgagcagttgcagagcgggaag
atgaaagctttcctttccttggctcgcttctcagacgctcagtaccagagcatagtcaac
tatatgaagtcctccgagtttgaacacaagcaggctttattgaagaatgctaaagaggag
gtcggattaatgaaggagcatagagttcaaaccacaaggtacacagtgaaggttcaaagg
gagctggaattggacgagcgagccctcgatgctctgaaggaggatcgtaaacgctttctt
tgtaaagcagtagagaactacatcaattgtctagagagtggggaggaacacgacatgtgg
gtcttcaggctgtgctcactctggctggaaaactcgacagtgtttgaagttaataaaatg
atgaagcaaggtactgagaagatcccatcttacaagtttctacctttgatgtatcagctg
gctgctcgtatggggacaaagctacgcgaaagactgggattcaatgaagtccttaataat
ttgatatccagggctactttggaccacccccatcacaccttatttataatcctagcatta
gcaaatgcaaataaagatgacatactgcagaaaccactgggaacaaagagaagcggactg
acaaagagtgcccccaagcggatatccgaacttgatgaggagaggatggaagttgcccgt
aatataataaacaagatcagaaaacacagacctgaaatggtgaaagacatcgagaaactt
tgtgatgcatatatctttttagctaacatggatgcaaatcagtggaaagcacaaaggaaa
ggaattagaatcccagaagaccagcctattaccaaaataaaggacctccatgaggttgta
attcctaccatggaagtgaaggtggatccttcaggtaaatatgagaacctggtaacagtc
agttcatttagagctgagtttcgtttagcaggaggggtgaacctccctaaaattatcgac
tgtgttggatcagacggaaaggagaggaggcagcttgtcaagggtcgagatgatctaaga
caagatgctgtgatgcaacaggttttccaaatgtgtaacacgctgctgcagagaaatgct
gaaaccaggaaaagaaagttaacaatccgtagatataaagtggttcccctttcccagagg
agtggtgtcctggaatggtgtacaggaaccgttcccattggagagtttcttgttaaccct
gaagttggagcccacaagaggtacaggccaaaggactggaacagtatgcagtgccgaagg
aacatggttgataaacagaaatcagactttgaggccaaataccaaatttttatgaaagtt
tgccaaaactttccgccagtattccgctacttcttcatggaaaaattctttgatccagct
gtttggtttgagaagcgtctggcgtacacacgcagtgtggctacatcctcaatagttggc
tacatagttggtcttggggacagacatgtgcaaaacatcttgattgatgaggagtcagca
gagcttgtgcacattgatctaggggttgcatttgagcaggggaaaatccttcccactcca
gagacagttcccttcaggttaaccagagatatagtggatggaatggggattgctggagtc
gaaggagtctttagaaggtgctgtgagaaaacaatggaagttatgagaaattctcaagaa
gccttgctgaccattgttgaggtgttgctctatgatcccctgtttgactggaccatgaat
ccattgaaagccctttatctgcaggagagaactgaggaagatgcagaccttaatgcaacc
ctcaactctaccatgggaggtggaggtgatgaccaagaatgtaacagaaaatctagcaat
gatgcccaaaacattaacaaggtggcaggccgtgttcttctgagactgcaggaaaagctg
aaaggagtagaggaagggacagtcctaaatgtgggaggacaagtcaatcttctcatccag
caagccatggatcccaagaacctgagccgactgtttccagggtggcaaccttgggtgtga

DBGET integrated database retrieval system