KEGG   Latimeria chalumnae (coelacanth): 102347863
Entry
102347863         CDS       T02913                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type 3
  KO
K10137  zinc finger, matrin type 3
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102347863 (ZMAT3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 102347863
NCBI-ProteinID: XP_014341545
Ensembl: ENSLACG00000015780
LinkDB
Position
Un
AA seq 367 aa
MATAGDKWLKMAMNMNCRGAYLQNHCRNYSPYHPKIKDNNHFIHRLTDSKGNPAPPKGIS
HLPFQPMTPFQPMKSPPPQHEQRHLVTSTSVTPRPPSSVPPTLVRPPQPVQKPHRKEPLS
QAIQEEKPTREVDRDPALEGLCRPLYCKVCNVTLNSAQQAQAHYQGKNHNKKLKNYTATN
HYPSPSRASHTADTPAPQPPPPPPVVPQMSSPKVGRVILATENDYCKLCDASFSSPAVAQ
AHYQGKNHAKRLRLTEAQQNNLFTDSSQLNKRRPRKEGNEFKMMQNRRNVQNSQNNPASP
YFNPRPRLRIPRDLAMCVTPSGQFYCSMCNAGAIEEAEFRQHLESKQHKSKVSEQRYRSE
MENLGYA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggcaactgctggagataaatggttgaagatggcgatgaatatgaactgtagaggtgct
tatttgcagaaccactgtagaaattacagcccctatcatcctaaaattaaggacaacaac
cactttatacatagacttacagattcaaaaggcaatcctgccccacctaagggaataagc
catctgccatttcagccaatgaccccgttccagccaatgaagagcccacctcctcaacat
gagcagcgtcaccttgtcacatctacctcagtgaccccaaggccaccttcttccgtacca
ccaaccctagtgaggccacctcagccagtccagaagccccataggaaagagcctctatcg
caggcgattcaagaagaaaagccaacaagggaagtggaccgagaccctgccctagagggt
ctctgtagaccactgtactgtaaagtatgtaatgtcacactaaactctgcacagcaagcc
caggctcattaccagggtaaaaatcacaacaaaaagcttaagaactatactgccacaaat
cactacccaagccccagcagagcaagtcacacagcagatactccagctccacagcctcct
cccccacctccagtggtgcctcagatgagctcccctaaagtaggccgtgtgattctagcc
acagaaaatgactattgcaaactctgcgatgcctcgtttagctctcctgctgtggctcag
gctcactaccagggaaagaatcacgctaaacggctgcgactgacggaagcccagcaaaac
aacctattcacagattcatcacagcttaacaaaagaaggccaagaaaagaaggaaacgaa
tttaagatgatgcagaatagaagaaacgtgcagaactcacaaaacaatccagccagtccg
tacttcaacccccgcccccgtttacgaattccacgggatctggcaatgtgcgtcactccc
agtggccagttctactgttctatgtgcaacgctggagccatcgaagaggcggaatttcga
cagcacttggaaagcaaacagcacaaaagcaaagtttcagagcagcgctaccggagtgag
atggaaaaccttggctatgcataa

DBGET integrated database retrieval system