KEGG   Latimeria chalumnae (coelacanth): 102348269
Entry
102348269         CDS       T02913                                 

Gene name
GORAB
Definition
(RefSeq) golgin, RAB6 interacting
  KO
K19748  RAB6-interacting golgin
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102348269 (GORAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcm04131]
    102348269 (GORAB)
Membrane trafficking [BR:lcm04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    102348269 (GORAB)
SSDB
Motif
Pfam: Transcrip_act
Other DBs
NCBI-GeneID: 102348269
NCBI-ProteinID: XP_006005545
Ensembl: ENSLACG00000010617
LinkDB
Position
Un
AA seq 404 aa
MAGWVGFSEEELRRLKQQKDPAAVESPERLWRPPPTSKNRQQLQRERALQKQSQRVSKQD
RATQLLPDQKLSRPQAQQLPPAVLSPSSLVSTQEQAQQNNRNQQNKQGSLDQQETTKPAP
IVAVKAQDLAPEEGPPVVMKEEVELREKSRLEHLQLEQRLMEEKNKRKKALLAKAIAERS
RRTQAEAVKLKQIQKELQTLDNMVSNDIGILRNRIEQASWEYSQARKRFDKAEVEYVAAK
LDLHKKTEIKEQLAEHLCAIIQQNELRKAKKLEDLMQLLEMETDEERLELEIEVDQMLQQ
QQRAEEEEKMTNTASLPHIELPHNPAQVTQGEGNDNGETMLVERSKDSSEIPSEKTEMKP
VEDSNNSSNCNSATHGNKTGVSEPEFLSLQALTRLKSPLFASLI
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccggctgggtgggtttctccgaggaggagctgcggcggctgaaacagcagaaagat
cctgcagctgtagagtcaccagagaggctgtggcgacccccacccaccagcaagaaccgc
cagcaactgcagcgagaaagggccctacagaaacagagccagagggtaagcaagcaggat
agggcaacccaactccttccagatcaaaagctctcaagaccccaggcccagcagctgcca
cctgcagtcttatctccatcctctctcgtctcaacccaagagcaggcccagcagaacaat
agaaaccaacagaataagcagggctccctggaccaacaggagactaccaagccagcacct
atagtggcagtaaaagctcaggacttggcacccgaggagggaccacctgtagtgatgaaa
gaggaggtggaattgagagagaagtctcgtctggagcacctccagctagagcagcggctg
atggaagagaagaataagcgtaaaaaagctcttttggcaaaagctatagcagaaaggtca
agaaggacccaggccgaagctgtgaaactgaagcaaatccagaaggagctgcagaccctg
gataacatggtgtccaatgatattggtattctaagaaaccgaattgagcaggccagctgg
gaatactcacaggctaggaagaggtttgacaaggcagaggtggagtatgtggcagcaaag
ctagacctacataagaagacagagatcaaggagcagctggcagagcacttgtgtgccatc
atccaacagaacgagctacgcaaagctaaaaagctggaggatctgatgcagctgctggag
atggagacagatgaggagagattagaactggagatagaggtggatcagatgctacagcag
cagcaacgggcagaggaggaggaaaagatgaccaacacagccagcttaccccacattgag
ctgccacataacccagcacaggtgacacaaggggagggaaatgacaatggagaaactatg
ctggtggagcggagtaaagattcaagtgaaatcccttctgagaaaactgagatgaaacct
gtagaggactctaataattcttcaaactgtaatagtgcaacccatggaaacaaaactgga
gtgagtgagccagagtttctctctcttcaagcactaaccagactgaaaagtccactgttc
gcgtcattgatttaa

DBGET integrated database retrieval system