KEGG   Latimeria chalumnae (coelacanth): 102348548Help
Entry
102348548         CDS       T02913                                 

Gene name
PTEN
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00562  Inositol phosphate metabolism
lcm01100  Metabolic pathways
lcm04068  FoxO signaling pathway
lcm04070  Phosphatidylinositol signaling system
lcm04115  p53 signaling pathway
lcm04140  Autophagy - animal
lcm04150  mTOR signaling pathway
lcm04218  Cellular senescence
lcm04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102348548 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102348548 (PTEN)
   04070 Phosphatidylinositol signaling system
    102348548 (PTEN)
   04150 mTOR signaling pathway
    102348548 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102348548 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102348548 (PTEN)
   04218 Cellular senescence
    102348548 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102348548 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcm01009]
    102348548 (PTEN)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102348548 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     102348548 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     102348548 (PTEN)
Protein phosphatases and associated proteins [BR:lcm01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    102348548 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 102348548
NCBI-ProteinID: XP_006009982
Ensembl: ENSLACG00000005701
UniProt: H3A9V3
LinkDB All DBs
Position
Un
AA seq 404 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDKWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRSKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKHQLDYKPVALLFHKLAFETIPMFSGGTCNPLFVVYQLKVKIYTSPLGPTRREEKYMH
FEFPQPLPVCGDIKVEFFHKQNKMMKKEKMFHFWINTFFIPGPEENSDKVENGSVVGEKE
LDGIYSTERSDNDKEYLILTLAKNDLDKANKDKANKSFSPNFKVKLFFTKTVEEPSNSEA
SSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHPQITKV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactgccatcatcaaagaaatcgtcagcagaaacaaaagaagataccaagaggatggc
ttcgacttggatttaacctatatttatccaaacatcattgctatgggatttccagcagaa
agacttgaaggtgtatacagaaacaacattgatgatgtagtaaggttcttggattcaaag
cataaaaaccattataagatatacaacctatgtgcagaaagacattatgatgccaccaaa
tttaattgtagagttgcacaatatccttttgaagaccataatccaccacagctagagtta
atcaaacctttctgtgaagaccttgacaaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacgaactggtgtaatgatatgtgcatatttgcta
catcgaagcaaattcctaaaggcacaagaagccttagacttttatggtgaagtgaggacc
agagacaagaagggagtaacgattcccagccagaggcgctatgtatattactacagctat
ctgttgaagcaccagttggactacaaaccagtggcactgttgtttcacaagttggcgttt
gaaacaattccaatgtttagtggtggaacatgcaatcctctgtttgtggtctatcagtta
aaggtgaagatttacacctctcctctgggacccacaagacgtgaagaaaaatacatgcac
tttgagtttccgcagcccttgccagtgtgtggtgacataaaggtggagttctttcacaag
cagaacaagatgatgaaaaaggaaaaaatgttccacttttggataaatacattcttcata
ccaggacctgaagaaaattcagacaaagttgaaaatggcagtgtggttggagaaaaagaa
cttgatgggatttacagtactgagcgttctgataatgacaaggagtatcttatcctcaca
ttggcaaaaaatgatctagataaagcgaataaggacaaggccaacaaatccttttctcca
aacttcaaggtaaagcttttcttcacaaaaacagttgaagagccatcgaactctgaggcc
agcagttcaacttcagtaacgccggatgttagtgataatgaacctgatcattatagatat
tcagacaccactgactctgacccagaaaatgaaccttttgatgaagatcagcatccacag
ataacaaaagtctga

DBGET integrated database retrieval system