KEGG   Latimeria chalumnae (coelacanth): 102348720
Entry
102348720         CDS       T02913                                 

Gene name
SESN2
Definition
(RefSeq) sestrin-2
  KO
K20394  sestrin 2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102348720 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102348720 (SESN2)
SSDB
Motif
Pfam: PA26 CMD DUF5768
Other DBs
NCBI-GeneID: 102348720
NCBI-ProteinID: XP_014341071
LinkDB
Position
Un
AA seq 577 aa
MVEEVPVQDCTVEAACGRRATGAEPCQVEEEEEDPCWDIRKWAGLCSRDEKERAEAMETL
GRFFWARLEQSSTSPKGNLGDAPERKSREQPLPAEISKIGVLLLRLSRNCPFRDIREKSL
EVLQAAQDKRYKVPRPLGTGPSSFIPVQEILQEGAKNNDRQIFIEAFVSTGRVDHLLVVM
GLHPEYLTSFWKTQYYLLQMDGPLPYPYRHYIAIMASARHRCSYLVNLHIMDFLQAGGNR
EWLNGLNFAPQKLRNLNEINKLLAHRPWLITKEHIEALLTTGENSWSLAELIHAVVLLTH
YHSLSSFVFGCGINPELDHEGGHSFRPPSPRACDSDSCLRVEDYVNGHGAGDAMQEVEAL
MARMKLLQECRLDEEASQEEMATRFEKEKRESLLVAPSADEREFALPNVSRFVEDPEFGY
VDFTRRGEQTPPTLRAQDYSWEDHGYSLINRLYSEVGQLLDEKFQIVYNLTYHTMAMHCG
VNTSMLRRAIWNYIHCIFGIRYDDYDYGDVNQLLERSLKIYMKTVACYPERTTTRMYNGF
WRHFKHSEKVHVNLLIQESKMQAALLYVLRAITRYMT
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggtagaagaagtgccagtgcaggactgcactgtggaagcagcctgcggccgtagggca
acgggagcagagccatgccaggtagaggaggaggaggaggatccttgctgggacattagg
aaatgggcaggattgtgcagcagagacgagaaggagagagcagaagccatggagacgctg
ggtcggtttttctgggctcgcctggagcaaagcagcacctccccaaagggcaacctgggc
gatgcacccgagcgcaaaagccgagaacagccgctgcccgctgagatcagtaaaattgga
gtcctcttgctcaggttgtccagaaactgccctttcagagacatcagggaaaaaagcctt
gaggttttgcaagctgcacaggacaagagatataaagtccctcggccgctggggacgggc
ccaagctcattcattccagtacaggagattctgcaggaaggggcaaagaataatgacaga
cagatcttcatcgaagcctttgtgtccacgggccgggtggatcatctcctggtggtaatg
gggttgcatccagagtacctgaccagcttctggaaaacgcagtactacttgctacagatg
gacggacccctgccttacccctaccggcactacattgcaatcatggcctctgccagacat
cggtgttcttatcttgtcaacctgcacataatggatttcctgcaagcaggaggaaatcga
gagtggttaaatgggttaaactttgcaccgcagaaactgaggaacctgaacgaaatcaac
aagctgctggcccacaggccctggctgatcacgaaggagcacatagaggctttgctgaca
actggagagaacagctggtccttggctgaactgatccacgctgtggttctcctcacgcac
taccactcgctgtcgtccttcgtgtttgggtgcgggatcaaccctgagcttgaccatgag
ggtgggcactcattcagaccaccttcgccacgcgcctgtgactccgatagctgcctccga
gtggaagactacgtgaacgggcacggcgcgggtgatgccatgcaggaggtggaggctttg
atggcgaggatgaagctgctgcaggaatgcagattggacgaagaggccagccaggaggaa
atggcaactcgctttgagaaggagaagagggaaagtctgcttgtggccccttcagctgac
gaaagggagtttgccctgccgaacgtctcccgttttgttgaggatccagaatttggttac
gtagacttcacaaggcgaggagagcaaacgccacctactcttcgggcacaggattactcc
tgggaagaccatggttattctttaataaaccgcctgtattcagaagttggtcagttgttg
gatgagaagtttcagattgtgtacaacctgacttaccacaccatggccatgcactgtggc
gtcaacacctccatgctgcgcagggccatatggaactacatccactgcatatttgggatc
aggtatgatgattatgattatggagacgtcaaccagctcctggaacgtagcttaaaaatt
tatatgaaaactgtggcctgttacccagagagaaccaccacaagaatgtataatggcttc
tggagacatttcaagcactcagaaaaggtacacgtgaacttgctaattcaagaatccaaa
atgcaggcggcactgctgtatgtattaagagccatcacgcggtacatgacttga

KEGG   Latimeria chalumnae (coelacanth): 102356692
Entry
102356692         CDS       T02913                                 

Gene name
SESN3
Definition
(RefSeq) sestrin-3
  KO
K10141  sestrin 1/3
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102356692 (SESN3)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 102356692
NCBI-ProteinID: XP_006003800
Ensembl: ENSLACG00000009225
UniProt: H3ALF0
LinkDB
Position
Un
AA seq 475 aa
MGRIEQSVPAAASSTSTGVENMIIRSHSRSPVQSSHCQRVQPQVAKMSLEKDRPQLLFVK
ALASRGRLDPVTQQMGYHPQYLDSFLKTQHYLLHMDGPLPFPCRHYIAVMAAARHGCRYL
VNLHVSQFLRVGGDPQWLQGLEFIPQRLRNLNQINKILAHRPWLIRKEHIESLLKIEEQC
WSLAELVHAVVLLAHYHALASFVFGSGCDQEDRPDSRNLFKIPLVPLGNQCFCDAANGNY
CSQELLRINRRRSLDSCVELETLRDRMQRIHIENENREEKTCERTRALPGEQEEDCEDEV
VSPPDLSRYVEDPEFGYQDFARREEEQLQIFRVQDYSWEDHGFSLVNRLYSDIGHLLDEK
FRTVYALQNGTMAKRQGCDNAVFKRGIWNYIHCMFGIRYDDYDYGEVNHWLERSLKVYIK
TVTCHPEKTCSQMFERFWKQFKHSEKVHVNLLILEARIQVELLYALRAITQHMIS
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggggcggattgaacagagcgtcccggccgccgctagtagtaccagcaccggcgtagag
aacatgatcatccggagtcacagcaggagtcctgtccagagcagccactgtcagagagtg
caaccccaggttgcaaagatgagtcttgagaaggatcgcccacagttgctgtttgtgaag
gcgctggctagtcgagggaggttggacccggtcactcagcagatgggctatcatccacag
tacttggacagtttcctaaagacccaacactacctgctacacatggatggaccgctcccc
ttcccttgccgacactacattgcagtcatggcagccgcacgacatgggtgtcggtacctg
gtgaatctccatgtgtcacagttcctgcgagtcggtggagacccacagtggctccaagga
ctggagttcattccccaaagactgaggaacctcaatcagatcaataaaatcctggcacat
cggccctggttaatccggaaggaacacattgagagtttactgaagattgaagagcagtgc
tggtcactggcagagttggttcatgctgttgttcttcttgctcattaccacgctctcgcc
agcttcgtctttggctctggctgtgaccaggaggatcgtccggacagccgcaatctcttc
aagataccactggtgccgctaggaaaccagtgcttctgtgatgctgccaatgggaactac
tgcagtcaggaactgctgaggataaaccgacgaaggtctctagattcgtgtgtggagttg
gagacactgcgggatcgaatgcagagaatccacattgagaacgagaatcgggaggagaag
acctgtgaaagaaccagagcgttaccaggagagcaggaggaagattgtgaagatgaagtg
gtctcccctcccgatctctcccgctatgtggaggaccccgagtttggttaccaagacttt
gcccgaagggaggaggagcagctgcagatatttcgggttcaggattactcctgggaggac
catggattctcgttggtgaaccggctgtattctgacatcggacacctactggatgagaag
ttccggacggtttacgccttacagaatggcaccatggcaaaacggcagggctgtgacaat
gctgtgttcaaacgggggatctggaattacatccactgtatgtttggaattaggtacgat
gattatgactatggggaggtgaatcactggttggagagaagtttaaaggtttacattaaa
actgtaacctgccatcctgagaaaacctgctcccagatgtttgaaagattctggaaacag
tttaaacactcagagaaggtacatgttaacctgctgatcctggaggcccggatacaagtg
gaacttctctacgcactccgtgccatcacacagcacatgatctcctga

KEGG   Latimeria chalumnae (coelacanth): 102361950
Entry
102361950         CDS       T02913                                 

Gene name
SESN1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102361950 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 102361950
NCBI-ProteinID: XP_014341870
LinkDB
Position
Un
AA seq 478 aa
MFLEKAADIWHGGQSFLTKETSDCMDKVTKELGVRIPRPLGRGPSQFIPEKEILQIGKED
AHIHALFEEAFAALGRLDNITLLMVFHPQYLHSFLKTQHYLLQMDGPLPLYFRHYIGIMA
AARHQCSYLVNLHVDDFLQVGGDRKWLSGLEFAPQKLQNLGELNKILAHRPWLLTKDHIE
RLLKAEEHSWSLAELIHAVVLLTHYHSLASFAFGCGISPEIHTEGGHTFRPPSVSNYCAC
DIANGNSGLEEASDTSCEVEALMEKMKQLQEYRDEEEASQEEMTTRFEREKTESMLVILA
GDEDSLPNRDVSRHFEDTSYGYKDFSRRGEHVPTLRAQDYNWEDHGFSLVNRLYPDVGQW
LDDKFQIAYNLTYNTMAMHKDVDTSMLRRAVWNYIHCMFGIRYDDYDYIEINQLLDHGFK
VYIKTVVCSPEKTTKKMYDSFWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRYMT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgttcctagaaaaagcagcagacatttggcacggtgggcaatccttcctgacaaaggag
acctcagactgtatggacaaggtgaccaaggaacttggagtaagaattcctagaccactg
ggacggggaccaagtcagttcatcccagagaaagagatccttcagataggaaaagaggat
gcacatattcacgctttatttgaagaagcctttgctgctttgggtcgtctagacaatatc
accttgttgatggttttccacccccagtacttacacagttttctgaaaactcaacactac
ttgctacagatggatggtccactgcctttatatttcagacactacattgggatcatggct
gcagccagacatcagtgctcctacctggtcaatcttcacgtggatgacttcctgcaagta
gggggagaccgcaaatggctcagtggtttggagtttgctccacagaagctgcagaactta
ggagagctgaataaaatcctggcccacagaccatggcttctcaccaaagaccacattgag
cgacttctgaaggctgaagagcacagctggtccctggcggagctgatccacgctgtagtg
ctgctgacgcattaccattctctagcctcttttgcctttggatgtgggatcagtccagag
atccacactgaaggaggccacaccttccgccccccttctgtcagcaactattgtgcttgt
gacattgccaatggaaacagtgggttagaagaagcttctgacacctcatgtgaggttgaa
gcacttatggagaaaatgaagcagctgcaggaatacagggatgaagaggaggcgagtcaa
gaggagatgactacacgctttgagagagagaagacggaaagcatgctagtcatacttgca
ggggatgaggactccttgccaaatagagatgtttcccgtcactttgaggacacaagctat
ggttacaaagatttttccagacgtggagaacatgttcctactttacgcgctcaggattac
aactgggaagatcatggcttctcgctggtcaatcgcctttatcctgatgtcggtcaatgg
ctggatgataagttccagattgcttataacttgacttataacaccatggcaatgcacaag
gatgtggatacctcgatgctgagacgtgcggtatggaactacattcactgcatgtttgga
atccgatatgatgattatgactatattgaaatcaaccagctgttggatcacggtttcaaa
gtttacatcaaaacggtggtctgcagtcctgagaagacgacaaaaaaaatgtatgatagc
ttctggaggcagttcaaacactcagagaaggtgcatgtaaatttgcttcttatggaagca
cggatgcaagctgagctgctttatgctctaagagccattactcgttacatgacatga

DBGET integrated database retrieval system