KEGG   Latimeria chalumnae (coelacanth): 102348838Help
Entry
102348838         CDS       T02913                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00020  Citrate cycle (TCA cycle)
lcm00190  Oxidative phosphorylation
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
Module
lcm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lcm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lcm_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102348838 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102348838 (SDHA)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102348838 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HTH_ABP1_N
Motif
Other DBs
NCBI-GeneID: 102348838
NCBI-ProteinID: XP_006000044
Ensembl: ENSLACG00000007077
LinkDB All DBs
Position
Un
AA seq 664 aa AA seqDB search
MATLSRASRVVAKRLLADRTQLPAVSQAVSRDFHFTIYGKKEKTSKVTDSLSTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDDWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSRTEAGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCME
DGSIHRLRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRAMTIEIREGRGCGPD
KDHVYLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VITHDNGVDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAESNKPGET
VPSIKPNAGEESVANLDRLRFANGSIRTSELRLNMQKAMQGHAAVFRTGSTLQEGCEKLS
ALYGHLDDLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDFKDR
IDEYDFSKPVQGQKKKPFAEHWRKHTLSHMDCTTGKVDLQYRPVIDKTLNEDECAAVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggctaccttgagccgggcgtcccgggttgtggcgaagcggttgttggcggatagaacg
cagctgccagcggtgtcccaggctgtgtcacgtgacttccacttcaccatttatggaaag
aaggagaaaacttctaaagttacagattcgctttccacccagtacccagtggtcgaccat
gagtttgatgcagttgtggtgggggctggtggcgcaggtttgcgagcagcgtttggcctc
tcggaagctggcttcaacaccgcctgtgttacaaagcttttccctactaggtcacatacc
gtggctgcgcagggtggaattaacgcagcattgggcaacatggaggatgacgactggcga
tggcatttctatgacacggtcaaagggtctgattggttaggcgatcaggatgctattcac
tacatgactgaacaggcacctgctgcggttattgagctggaaaattacgggatgcctttc
agtagaactgaggcagggaagatctatcagcgtgcttttggtggccagagcttaaagttt
gggaaaggtgggcaggctcatcgctgctgctgcgtggctgaccggacaggacactctttg
ctgcacactctatatggcaggtctctgagatatgatactagctactttgtggaatatttt
gccctggatcttctgatggaaaacggagagtgtcggggtgtgattgcgctttgcatggaa
gatggatccattcaccgactcagagcaaagaacacagttattgccacgggaggctatggg
cgtacctacttcagctgtacttcggcccataccagcacgggtgatggcacggctatggtg
accagagctggccttccctgccaggacttggagtttgtgcagtttcatcccacagggatc
tatggcgctggatgtctcatcacagaaggctgtcgaggcgaaggtggcattctcatcaac
agcgaaggggaaaggtttatggagcgctatgcccctgtcgcaaaggatctggcatccaga
gatgttgtgtcacgtgctatgacaattgaaatccgtgaaggaagaggctgtggtcctgac
aaagaccacgtatacttgcagctgcatcatttaccgcctcagcagctcgcaacacgcctt
cctggcatctcggagacagccatgatttttgctggcgttgatgtcacaaaggagccaatc
ccagttcttcccactgtgcattacaacatgggtggtattcccacaaactacaaagggcag
gtaataactcacgataatggtgtggataaagtagtacctggcttatatgcctgtggcgag
gctgcaagtgcttctgtgcatggtgctaatcgattgggagccaactccctgttggacctg
gtggtcttcggccgtgcgtgtgccctaagcattgcagaatccaacaaacctggtgagact
gttccatccatcaagccaaatgctggagaagaatcggtggcaaatctagacagacttcga
tttgcaaatggtagcataagaacatccgagcttaggcttaacatgcaaaaggctatgcag
ggccatgcagcagtgttccgcacgggttccacgttacaagaagggtgtgagaagctgagt
gctctgtatgggcacttggatgacctgaagacctttgacagaggtattgtgtggaacaca
gatctggtggagaccttggagctccagaatctgatgctttgtgctttgcagaccatctat
ggcgctgaagctcggaaagagagtcgtggagcgcatgccagggaggatttcaaggacagg
atagatgaatatgacttttctaaaccggtccagggacaaaagaagaagccctttgctgaa
cattggagaaagcacacattatcccatatggattgcaccactggaaaggttgatctgcag
tacagaccagtaattgacaaaacactaaatgaagacgagtgtgctgcagtcccgccggct
atccgctcctattag

DBGET integrated database retrieval system