KEGG   Latimeria chalumnae (coelacanth): 102349107
Entry
102349107         CDS       T02913                                 

Gene name
CCNB2
Definition
(RefSeq) cyclin B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102349107 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102349107 (CCNB2)
   04114 Oocyte meiosis
    102349107 (CCNB2)
   04115 p53 signaling pathway
    102349107 (CCNB2)
   04218 Cellular senescence
    102349107 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102349107 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102349107 (CCNB2)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102349107 (CCNB2)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102349107 (CCNB2)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102349107 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Branch
Other DBs
NCBI-GeneID: 102349107
NCBI-ProteinID: XP_005998781
Ensembl: ENSLACG00000002466
UniProt: H2ZZD6
LinkDB
Position
Un
AA seq 404 aa
MALSRRAAVLREMNNEVSSKVITKSTVVGKRAVLGDLGNKVETRGMRQVKREESFKVPVA
KATKKPLNKPTGNVAPQPGNVASVKPKVQLPVNPKEPPSPTPMEVSMKEEELCLAFSGAL
LNVEDIDAGDDDNPQLCSEYVKEIYQYLRQLEVQQSICPKYLEGQEINERMRAILVDWLI
QVHSRFQLLQETLYMTIALMDRFLQVQPVSRKKLQLVGVTSMLLASKYEEMYVPEIGDFV
YITDNAYTKGQIREMEMIILKRLNFNLGRPLPPHFLRRASKAGNADVEKHTLAKYLMELT
LMDYDMVHYHPSQVAAASLCLSQMLLDKSKWTITQQCYTLYTEEDLRPIMQHIAKNVFRL
NGGLTKHVAIKNKYASGKMMKISTIPQLKSKEIEELASPLLASS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctctgtccagacgagctgccgttttaagagaaatgaataatgaagtgagttccaag
gttataactaaatctacagtggtgggtaagagagcggtgcttggagaccttggaaacaaa
gttgaaacaagaggaatgcggcaagttaagagagaggagagcttcaaagttccagtggcc
aaagctacaaagaaacctctaaacaagccaactggaaatgttgctccacagcctggaaat
gttgcttcagtgaagcctaaggttcagctacctgtaaacccaaaggaacctccatcccca
actccaatggaggtttccatgaaagaggaggagctatgccttgccttttctggggctttg
ttgaatgtggaagacattgatgcaggggatgatgataaccctcaactctgcagtgaatat
gtaaaagaaatttatcagtacttgaggcagctggaggtacaacaatccatctgtcccaaa
taccttgaaggacaggagatcaatgaacgaatgcgagcaatccttgttgactggctgatc
caagtccattctagattccaactgttgcaggaaactctctacatgaccattgcattaatg
gaccgcttcctacaggtgcagccagtttcccgcaagaaactccaattagttggtgtaaca
tcaatgctgttggcttccaaatatgaagaaatgtatgtaccagaaataggagactttgtt
tatatcacagacaatgcctacaccaaaggacaaataagagaaatggaaatgattattcta
aaacggttgaattttaatttgggtcgcccgttaccaccccactttcttagaagagcgtca
aaagctggcaacgctgatgtggagaagcatacgcttgcaaaatacttaatggagcttaca
ctaatggactatgacatggtgcactatcatccctcacaagttgctgcagcttccctgtgc
ctatcgcagatgctcttggataagagtaaatggacgataactcaacagtgctacactctc
tatactgaagaggatctgcgccccatcatgcaacatattgccaaaaatgtcttcaggctt
aatggaggtttaacaaaacatgttgctatcaagaacaaatatgcaagcggcaagatgatg
aagatcagcacaattcctcagctaaagtctaaagaaatcgaagagctagcttcacccttg
ttggctagctcatga

KEGG   Latimeria chalumnae (coelacanth): 102359547
Entry
102359547         CDS       T02913                                 

Gene name
CCNB1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102359547 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102359547 (CCNB1)
   04114 Oocyte meiosis
    102359547 (CCNB1)
   04115 p53 signaling pathway
    102359547 (CCNB1)
   04218 Cellular senescence
    102359547 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102359547 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102359547 (CCNB1)
   03036 Chromosome and associated proteins [BR:lcm03036]
    102359547 (CCNB1)
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102359547 (CCNB1)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102359547 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_C_2 SGS
Other DBs
NCBI-GeneID: 102359547
NCBI-ProteinID: XP_006010328
Ensembl: ENSLACG00000006996
UniProt: H3AE34
LinkDB
Position
Un
AA seq 404 aa
MALRVSRTVRVQAENPKSKVTGKSGSASMAGLKPRSALGDIGNKVPKETVPAKKEVKIVA
TKVNPRKPIRSEVTTEATNLSTPVADVKKQAIETKAPQCLSPMEVSTGLPEEELCHAFSD
VMLQVKDVDADDGDNPMLCSEYVKDIYKYLRQLEVEQAVRPKHLEGQEVTGNMRAILIDW
LVQVQIKFRLLQETMYMTVAILDRFLQNHPVPKKMLQLVGVTAMFVASKYEEIYPPDIGD
FVFVTNNTYTKRQVREMEMKVLWELDFGLGRPLPLHFLRRASKTAEATSEQHTLAKFLME
LSMVDYEMAHFPPSQIAAAAFCLALKVLDAGAWTPVLQHHMSYTEEDLIPVMEHMAKNVV
KVNEGLTKHMAVKNKYTSSKQMKISTLPQLKSAVVKEMARPLMS
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctctgcgtgtgtctaggactgttcgtgttcaagcagaaaaccccaagtcaaaagtg
actgggaaaagtggtagtgcttcaatggctggattaaaacccagatcagcgttgggagat
attgggaacaaagtacctaaggaaactgtacctgctaaaaaggaagttaaaatagtggca
accaaagtaaatcccaggaaaccaattaggtcagaggtgacaactgaagcaactaatctt
tcaactcctgtagcggatgtgaagaaacaggccattgagacaaaggcacctcaatgccta
agcccaatggaagtatctaccggtcttcctgaggaagagctctgccatgcattttcagat
gtaatgcttcaagtgaaagatgttgatgcagatgatggagataatccaatgctctgcagt
gaatatgtaaaggatatctacaagtacttgagacagctggaggtggaacaagctgtcaga
ccaaaacacctggaagggcaagaagttactggcaacatgcgtgccattctgattgactgg
cttgtgcaggttcagattaaattcaggctccttcaggagaccatgtacatgactgtagcc
atccttgatcggtttcttcagaatcatcctgtacccaaaaagatgctgcagctagttggt
gtcacagcaatgtttgttgcttccaaatatgaagagatatatcctccagatattggggac
ttcgtctttgtcacaaacaatacttacacaaaacgccaggttagagagatggagatgaaa
gttctttgggaacttgactttggtcttggccgtccccttcccttgcattttctacggcga
gcttccaagactgcagaagcaacatctgagcagcatactctagccaaattcctgatggaa
ctaagtatggtggactatgaaatggcacacttccctccatcgcagattgctgctgctgcc
ttttgccttgctcttaaggttcttgatgctggtgcctggacacctgttctgcagcatcac
atgtcctacactgaggaggacttgattcctgtaatggaacacatggctaagaatgttgta
aaagtcaatgaaggacttacaaaacatatggctgtgaagaataagtataccagcagcaaa
cagatgaagattagcacacttccacagctgaagtctgcagtggtcaaggaaatggccaga
cctctaatgtcctag

KEGG   Latimeria chalumnae (coelacanth): 102360112
Entry
102360112         CDS       T02913                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04114  Oocyte meiosis
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102360112
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102360112
   04114 Oocyte meiosis
    102360112
   04115 p53 signaling pathway
    102360112
   04218 Cellular senescence
    102360112
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102360112
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcm03032]
    102360112
   03036 Chromosome and associated proteins [BR:lcm03036]
    102360112
DNA replication proteins [BR:lcm03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102360112
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102360112
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF5088
Other DBs
NCBI-GeneID: 102360112
NCBI-ProteinID: XP_006013721
LinkDB
Position
Un
AA seq 283 aa
MFCSEYAKDVYRYLKQLEMERLIRPRYLEGQEITGNMRAILIDWLVQVHLKFCLLQETMF
LTVAIIDRFLQNSPASKRTLQLIGVTAMLVASKYEEVYPPEICDFVLITNNTFSKWNIQE
MERRILKELDFALGCPISLCFLQRASKIGGATAEEHTLGKYFLELSMVDYEMVHYPPSQI
AAASCLLAIGLLSGGKWTPILQHYLCYNEGDLIPIMQHIAKNVVRVNEGMTKHMAVKNKY
ASIKQMRISTIPHLKSTRILELAEPLLPPPPQNIDCGSLSCNL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgttttgcagtgaatatgcgaaagatgtctaccgttacttgaagcaacttgagatggag
cgactgataagaccaagatatctggaaggacaggagataactggaaacatgcgtgctata
ctcatcgactggcttgtacaagtccatttaaaattctgtctgttacaagaaaccatgttt
ttgacagttgccatcattgacagatttttgcagaacagtcctgcttcaaaaagaacatta
cagctaattggtgtgacagctatgctcgttgcctcaaaatatgaagaggtgtatcctcca
gagatatgtgactttgtgctcatcacaaacaacactttctccaaatggaatatacaggaa
atggagaggaggattttgaaggagttggattttgctcttggttgcccaatatcgctatgc
tttttacagagagcttcaaaaattggtggagcaactgcagaagaacacactttaggtaaa
tatttcctagagttatcaatggtggattatgaaatggtgcactatcctccatcccagatt
gcggctgcttcctgtttgttggctattggattacttagtggaggcaaatggacccctatt
ctgcagcactacctgtgttataatgaaggagatctaattcctatcatgcaacacattgca
aaaaatgttgtgcgtgttaatgagggaatgaccaaacatatggctgtcaaaaacaaatat
gccagcatcaagcaaatgaggatcagcaccattccacacctgaaatcgacacgcatccta
gaacttgcagaaccacttcttcctccacccccccaaaatattgactgtggtagtttgagc
tgtaatctgtga

DBGET integrated database retrieval system