KEGG   Latimeria chalumnae (coelacanth): 102349412
Entry
102349412         CDS       T02913                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102349412 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102349412 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102349412 (FAS)
   04217 Necroptosis
    102349412 (FAS)
   04115 p53 signaling pathway
    102349412 (FAS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102349412 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:lcm04050]
    102349412 (FAS)
   04090 CD molecules [BR:lcm04090]
    102349412 (FAS)
Cytokine receptors [BR:lcm04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102349412 (FAS)
CD molecules [BR:lcm04090]
 Proteins
  102349412 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 DUF2207 Phage_holin_3_6 Chordopox_A13L
Other DBs
NCBI-GeneID: 102349412
NCBI-ProteinID: XP_006011164
LinkDB
Position
Un
AA seq 327 aa
MGFAFVTRVIFLPLVVTIVSSVGAGKEQNASFIHLYTKRLAKREITCCTHETTTDNRCCK
YCPKGHHINETCECEPCDIGTYLDERNCEEKCRRCDTCDLNEGLEEVTACNTIRNVVCQC
KENFYCTNTMAESCKECISCDKCKGSPHETICTSVCKLNGNNDTKAGSWWITTLVAVLIL
VAVAIAVAVGVRKYSLYQKGRNNQVIKRKSDPEVYPMLPDADLRPILQDIADELGINEIK
SFVRRNSVNQPVIDRIREEHAAVEEQRYQLMLAWYQQHGRTGAATVLISTLRKMNKNAAA
DSVLKKLENYSVNQANGSSSNNNVSDS
NT seq 984 nt   +upstreamnt  +downstreamnt
atggggtttgcttttgtgacaagagttatatttctgccgttggttgtcacaattgtttca
tcagttggagctgggaaagaacaaaatgcatcctttattcacctatatactaaaaggctt
gcgaagcgggaaattacatgttgtacacatgaaactacaacagataatcgctgctgtaaa
tattgccctaaaggacaccatataaacgagacttgtgaatgtgaaccatgtgatattgga
acttaccttgatgaacgtaactgtgaggaaaagtgccgtcgatgcgacacatgtgatctt
aatgaaggtttagaagaagtaacagcatgtaacacaatcagaaatgtagtatgccagtgc
aaagaaaacttttactgcactaataccatggctgaaagctgtaaagaatgcatctcttgt
gacaaatgtaaaggcagtcctcacgagacgatctgcacatctgtttgcaagcttaatggt
aacaatgatacaaaagctggatcatggtggataaccactcttgttgcagttttaatttta
gttgcagttgcaattgcagttgcagtcggtgtacgaaagtacagtttgtaccaaaaaggt
cgcaacaatcaggtgattaaaagaaaaagtgatcctgaggtatatccaatgctaccagat
gctgatctacggcctatcctgcaagatattgcagatgaacttgggataaacgagataaaa
agctttgttcgaaggaatagtgtgaaccagcctgttattgaccgtattagagaggaacat
gctgctgtagaggaacagcgttatcagctaatgttagcatggtaccaacaacatggcaga
actggagctgctacagtcctcattagcacgctgagaaaaatgaacaaaaatgcagctgct
gactcagttttgaagaaactagaaaattattctgttaaccaagcaaatggtagtagtagc
aataacaatgttagtgacagctag

DBGET integrated database retrieval system