KEGG   Latimeria chalumnae (coelacanth): 102349614
Entry
102349614         CDS       T02913                                 

Gene name
PIDD1
Definition
(RefSeq) p53-induced death domain protein 1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102349614 (PIDD1)
   04115 p53 signaling pathway
    102349614 (PIDD1)
SSDB
Motif
Pfam: Death ZU5 Peptidase_S68
Other DBs
NCBI-GeneID: 102349614
NCBI-ProteinID: XP_014353993
LinkDB
Position
Un
AA seq 445 aa
RKDIAVCRVCHFSWFVVISRLVVNRCPVPHQGALLFSTVDPNIKVTFPPGATEETRMVKM
QVLQVSAEEIQEMAEDSDSITSPLVCLSQSSTANFLKPVKIQLPLPPGVTALNLDRSKLH
LLHGDAQAYTWTDITQQVVLEFTHLYAFFEVTHFSWYWLWYTTKAYVGGIAKKVYERLRL
YPVNFLALQRKRDPEQVLLQCVSKHKVDMILNKLQDRYRGPEPSDVVDLFEGEQFFAAFE
KGLDIDADRPDCLDGRISFTFYSYLKNSKEIYVTSPLDRRVQAVKGQVGFCLYSFLSTQK
LKSQARQDRHGNHVTHQPLNLGNEETGYLTEANLLGIARQIGADWRKIGINLGFSYQDLQ
RIEYNNREDLDKQILEMLFSWAHLSASSPDSVKKLIQAMEESDRQDIADEIQSVIALGKQ
KYRESIRRVGLDPESSNEDFAIAMV
NT seq 1338 nt   +upstreamnt  +downstreamnt
cgaaaggacatagcagtctgcagggtctgccatttctcctggtttgtggtgatctcccgg
ctggttgtgaacagatgccctgtcccccatcagggggcgctgctcttctccaccgtggat
ccaaacattaaagtgaccttcccgcctggtgccacagaggaaacccgcatggtcaaaatg
caggttttacaggtttctgctgaagaaatccaggagatggctgaagattctgactccatc
accagcccactggtctgcctgtcccagagttccactgcaaacttcctcaaaccagtcaaa
atccagctgccgttaccccctggggttacagcactgaacctggatcgttccaaactgcac
ctgctccacggagatgcccaagcctacacctggacagatatcacccaacaagtagtcctg
gaattcacacacctctatgctttctttgaggttacccacttctcatggtactggctgtgg
tacaccactaaggcatacgtgggcggaattgccaagaaagtgtatgaaaggctgaggctg
tacccagtaaactttttggctctgcagaggaagagagacccagagcaggttttactgcag
tgtgtctccaaacacaaggtggacatgattctgaacaagcttcaggaccgataccgggga
ccagaaccctctgacgttgtggacctgtttgaaggggagcagttttttgccgcgtttgaa
aagggactggatatcgatgcagatcgcccagactgcttggatggaagaatttcctttacc
ttttattcttacctgaagaacagtaaagagatttatgtgacgtctccactggacagaagg
gtacaagctgtgaaaggacaggtaggtttttgtttgtattcatttctttccacacagaaa
ttgaagtctcaggcaagacaggatagacatgggaatcatgtgacccaccagcctctaaac
ctgggaaatgaggaaactggctaccttactgaagctaacctcctgggcattgccagacag
attggagcggattggagaaagattgggataaatctgggattctcttatcaagacctgcag
aggattgaatacaataaccgggaagacctggacaaacagatcctggagatgttgttttct
tgggcccatctcagtgccagctccccagactctgtaaagaagctcatccaggccatggag
gagagtgacaggcaggacatcgcagacgagattcagtctgtcatcgcactgggcaagcag
aaataccgtgagtccatccgccgggttggactggatcctgagagcagtaatgaggatttt
gccattgccatggtgtaa

DBGET integrated database retrieval system