KEGG   Latimeria chalumnae (coelacanth): 102349989
Entry
102349989         CDS       T02913                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm04620  Toll-like receptor signaling pathway
lcm04621  NOD-like receptor signaling pathway
lcm04622  RIG-I-like receptor signaling pathway
lcm04625  C-type lectin receptor signaling pathway
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102349989
   04217 Necroptosis
    102349989
   04115 p53 signaling pathway
    102349989
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102349989
   04621 NOD-like receptor signaling pathway
    102349989
   04622 RIG-I-like receptor signaling pathway
    102349989
   04625 C-type lectin receptor signaling pathway
    102349989
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102349989
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102349989
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcm01002]
    102349989
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102349989
Peptidases and inhibitors [BR:lcm01002]
 Cysteine peptidases
  Family C14: caspase family
   102349989
SSDB
Motif
Pfam: Peptidase_C14 DED Dsl1_N
Other DBs
NCBI-GeneID: 102349989
NCBI-ProteinID: XP_005995451
Ensembl: ENSLACG00000001849
UniProt: H2ZXE8
LinkDB
Position
Un
AA seq 539 aa
MELRKKLHEVDEELGREDVEALKFLCKSHIGARKLNRMESGKELFKALEDEDLMQDDAFI
VAELLYIIKHYSLLRKLGVNKETMHEQLPVKGVISRYRKFLFELSEEITKQDLKAAKFLL
QPVLPKCKLQDDMSMLGLLIEMEKQELLGEDQIEMLEKVCTTILPELGKRISKYKTELMV
PKQETKPFENVMSSQGPEPLEPWAFIKHQSGAKPFTERYISRNQESNNSGQRFETLSTKF
VQISVTGDDKNHASAYDNRKGSIDVINNSSRTSSVTIEQENSMDFPTYRMNHKHRGYCLI
ISNYDFSSLLPARRGTDTDTTALENVFTWLGFEVKIHRDKSAAEIRDIMKEFQGKDHKNN
DCFACCILSHGESGTILGTDGCCIPIREITSHFTAQKCQVLAGKPKLFFIQACQGKKYQN
PVFLESDAKNPNSIQETRVVNPQESIPEEADFLLGMATVDGFLSFRHIREGTWYIQSLCK
NLCVYVPRGEDLLAILTKVNEDVSKQTAMRESWKQMPQPAFTLRKRLIFPVPTNALPQL
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggaattgcgcaaaaagctccatgaagttgacgaggagcttggacgtgaagatgtggaa
gctctcaagtttttgtgcaaaagccacattggggctagaaagctcaacaggatggaatct
ggaaaggagctctttaaagcattggaagatgaggatttaatgcaagatgacgcattcata
gtagctgaacttctgtacataattaagcattattctttgttgagaaagttaggagtgaac
aaggagactatgcatgaacagttgccagtgaagggagtgatttcacgttacagaaagttt
ttgtttgagctctcagaagaaatcaccaagcaggatttgaaggctgcaaagtttcttttg
cagccggtgcttccaaaatgcaagctgcaagacgacatgtctatgctggggctcctcatt
gaaatggagaagcaagagcttttaggtgaagaccagatagagatgttagaaaaggtctgc
actaccatcttgcctgaattgggaaaacgaatatctaagtataaaacagaattgatggta
ccaaaacaagaaactaagccctttgaaaatgtcatgtctagccaaggcccagaacccctg
gagccatgggctttcatcaagcatcagtctggggcaaagcctttcacagagagatacatc
tccaggaaccaagaatctaacaattctggtcaaaggtttgagactctgtctacaaagttt
gttcagataagtgtcaccggagatgacaaaaatcatgcttctgcttatgataaccgaaaa
ggaagtattgatgtaattaataatagctcaagaaccagctcagtaacaattgaacaggag
aactccatggactttcctacctacagaatgaaccacaagcatcgaggatattgcctcata
ataagcaactatgatttttctagtctgcttcctgctcggaggggaactgatactgacact
accgctcttgaaaatgtatttacatggctgggatttgaagttaaaatacatcgtgataag
agtgctgcagagatcagggacattatgaaagagttccaaggaaaagatcacaaaaacaac
gattgttttgcatgctgcattctcagtcatggagaatcaggaaccattttaggaaccgac
gggtgctgcatacctatacgtgagataacctcccacttcacagcccaaaagtgccaggtg
cttgctggcaagccaaaacttttcttcattcaagcttgtcaaggcaaaaagtatcagaac
ccagtgtttctagaatcagatgcgaagaatcccaactccatccaggagacaagagtagtc
aaccctcaagagtccattcctgaggaggcagactttcttctggggatggccactgtggat
ggatttttgtctttcaggcacataagggagggtacttggtacatccagtcactgtgcaaa
aatctgtgtgtgtacgttccaagaggagaagatttgctcgctatccttacgaaggttaat
gaagatgtgagtaaacagaccgctatgagagagtcatggaagcaaatgccacagccagcc
ttcacgctgaggaagagactgatatttcctgttcctacgaatgctctcccccagctctag

KEGG   Latimeria chalumnae (coelacanth): 102355925
Entry
102355925         CDS       T02913                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm04620  Toll-like receptor signaling pathway
lcm04621  NOD-like receptor signaling pathway
lcm04622  RIG-I-like receptor signaling pathway
lcm04625  C-type lectin receptor signaling pathway
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102355925
   04217 Necroptosis
    102355925
   04115 p53 signaling pathway
    102355925
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102355925
   04621 NOD-like receptor signaling pathway
    102355925
   04622 RIG-I-like receptor signaling pathway
    102355925
   04625 C-type lectin receptor signaling pathway
    102355925
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102355925
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102355925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcm01002]
    102355925
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102355925
Peptidases and inhibitors [BR:lcm01002]
 Cysteine peptidases
  Family C14: caspase family
   102355925
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 102355925
NCBI-ProteinID: XP_014343563
LinkDB
Position
Un
AA seq 485 aa
MTFHDLLHDIQEDLCRENIAALKFLCHDFIPQRIQQRIVDGCDLFVELQNRNVLAADDTF
LLAELLYKINRNDLLKKYLKLKREKVEEELCVAGKAKINPYRKLLFDLSLDITEEELKRV
KFLLAPELKRSPLEQDVTILEVLIRMEKKGILEEGKLEYLKNICGQIRVDLVKKIENYEQ
QMKDLQQQGTQPLEMSFSQVNFNEDTYACRTVTTLVFNDEVYKMESRPCGYCVIINNFDF
KKSRESTGGKMLKDRPGTHKDGDDLRSTFEWLHFEVDVHTDLTAENILLTVEDYKRKDHR
ERDCFVFCILTHGEKGTVYGTDGQSVPISDITSCFTGKNCPSLVGKPKVFFIQACRGRRE
QEGVPVDTDCKDSSFDPQPESDAIPSGDIIPIWADYLVGFSTMEEYVSFRDKKKGSFYIE
SLCKYLQQCCPRKEDILSILTKVNNEVSQKFQKQMPEPKFTLTKKLIFPASPTEYPGTAA
VLKRI
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaccttccatgaccttctgcatgatattcaggaagacctttgcagggagaatatagct
gctttgaagttcttgtgtcatgatttcatcccccagcgtattcagcagaggatagtggat
ggatgtgacctctttgtagaactgcagaataggaacgtgctggcggcagacgacactttc
cttcttgctgaattgctgtacaagataaatcggaatgatttgctgaaaaaatacctaaag
ctaaaaagggaaaaagtggaggaagagctttgcgtagcagggaaagcaaagatcaaccct
tacaggaagctgctgtttgacctctcattggacataactgaagaggaattaaaacgtgtg
aaatttttactagcgcccgagcttaaaaggagcccattagaacaagacgtgacaatactg
gaagttctgattagaatggagaagaaggggattcttgaagaaggcaaactagagtatctg
aaaaatatatgcggacaaatccgggttgacctggtgaagaaaattgaaaactacgaacaa
caaatgaaagatttacagcaacaggggactcaacccctagaaatgagttttagtcaagtg
aacttcaatgaagatacttatgcttgtaggactgttactactttagtttttaacgatgag
gtttataaaatggagagtcggccttgtggatactgtgtaataatcaacaactttgatttt
aagaaatcaagagagagcacaggtgggaaaatgctgaaggacaggcctgggacacacaaa
gatggtgatgatttaagaagcacctttgaatggctgcactttgaagtggatgttcataca
gatttaactgctgagaacatccttctcacagtagaggattacaagaggaaggatcacaga
gagagagattgctttgtcttctgcatcctcacccatggggagaaagggactgtgtatgga
actgacggacagtcagtcccaataagtgacattacctcttgcttcacggggaagaactgc
ccttctctggttgggaaacccaaagtatttttcattcaggcttgtcgagggagaagggaa
caagaaggtgtgcccgttgacacggactgtaaggattccagttttgatcctcaacctgag
agtgatgccattccttcaggagacataattccaatatgggcagattaccttgtagggttc
tcaactatggaggagtatgtgtccttcagagataagaagaagggaagtttttatatagag
agtctttgcaagtacctacagcagtgctgcccaagaaaggaggatatattatctatcctt
acaaaagtaaacaatgaagtgagccagaagtttcagaagcaaatgccagagccaaagttt
acactgacaaagaaactaatctttccagcttcacctacagagtatcctgggacagcggct
gttttaaagaggatttga

KEGG   Latimeria chalumnae (coelacanth): 102356202
Entry
102356202         CDS       T02913                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm04620  Toll-like receptor signaling pathway
lcm04621  NOD-like receptor signaling pathway
lcm04622  RIG-I-like receptor signaling pathway
lcm04625  C-type lectin receptor signaling pathway
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102356202
   04217 Necroptosis
    102356202
   04115 p53 signaling pathway
    102356202
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102356202
   04621 NOD-like receptor signaling pathway
    102356202
   04622 RIG-I-like receptor signaling pathway
    102356202
   04625 C-type lectin receptor signaling pathway
    102356202
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102356202
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102356202
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcm01002]
    102356202
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102356202
Peptidases and inhibitors [BR:lcm01002]
 Cysteine peptidases
  Family C14: caspase family
   102356202
SSDB
Motif
Pfam: Peptidase_C14 DED Csm1_N
Other DBs
NCBI-GeneID: 102356202
NCBI-ProteinID: XP_005995476
LinkDB
Position
Un
AA seq 466 aa
MISRSTLHNIDEHLDKENVEALKFLCLDYIPQKAQEAIADGQDLFNALEKRGLSEENNFI
LPELLYRIKRIDLLNKLKLKKDEVEKELSIPGRAKISVYSARLTTLETGILCLSTEQTML
EVLIEMEKKGILGEYDLKELKEVCGNVNFTLVEKIENYEKKMKALQEQIPRMELNVNQPH
VREDGDNTSSASATSLDSSERVQEPQWSQAQIAKAYKMNSRPRGHFLLINNNNFTEARCK
VQKLKDLKDRKGTSKDADTLCSVFEWLHFEVDVHTDLTAEKILLTVEDYKRKDHRERDCF
VFCILTHGEKGTVYGTDGQSVSISDITSCFTGKNCPSLFGKPKVFFIQACQGSSVQKPVY
IETDSTVLDPLLDPEVKNSLPNEADFLIGMATVEESLSYRSVNTGTWYIQALCKNLKEMC
PRGEDVLSILTSVNNEVSQKFDPYRKGKQMPEPRFTLRKKLIFTVD
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgatttctcgatccactctacacaacatcgatgaacaccttgacaaggagaatgtagag
gctttgaagttcttgtgtctggactacatcccccagaaggctcaggaggcaatagcagat
ggacaagacctctttaatgcactggaaaaaaggggcttgtcggaggaaaataattttatt
ctgcctgaactgctatataggataaaaagaattgatttgttgaataaacttaagctaaaa
aaagatgaagtggagaaagagctctccattccagggagagccaagatttcagtttacagt
gctagattgacaacattagagactggaattctctgcttatccacagagcagactatgtta
gaagtgttaattgaaatggagaagaaagggattctgggagaatatgatctgaaggaacta
aaggaggtttgcggaaatgtcaacttcactttggtagagaaaattgaaaactatgagaaa
aaaatgaaagctttacaggagcagatccccagaatggaactgaatgttaaccagccgcat
gttagagaagatggagataatacttcatctgcctctgctaccagcttagattcttctgaa
agggtacaagaacctcagtggagccaagcacagattgctaaagcttataaaatgaacagc
agaccccgtggacacttcctgttaataaacaacaacaactttactgaagcaaggtgtaaa
gttcagaaactaaaggacttaaaagataggaaaggaacctctaaggatgctgatacttta
tgtagtgtctttgaatggctgcactttgaagtggatgttcatacagatttaactgctgag
aaaatccttctcacagtagaagattacaagaggaaggatcacagagagagagattgcttt
gtcttctgcatcctcacccatggggagaaagggactgtgtatggaaccgatggacagtca
gtctcaataagtgacattacctcttgcttcacggggaagaactgcccttctctgtttggg
aagcccaaagtatttttcattcaggcttgccagggtagttctgttcagaaacctgtgtac
attgagacagattccactgttctcgaccctcttctggatccagaagtaaaaaattctctt
ccaaatgaagcagactttcttataggaatggctacagttgaggagtctctatcctataga
agtgttaatacaggcacttggtatatacaggcactctgtaagaacttgaaggagatgtgt
ccaaggggcgaggatgttctctcaatcctcacaagtgtgaataatgaagtgagccagaag
tttgatccttacagaaaagggaagcagatgccagagcccaggttcaccttgcggaaaaaa
ctgatcttcactgtggactga

DBGET integrated database retrieval system