KEGG   Latimeria chalumnae (coelacanth): 102350333
Entry
102350333         CDS       T02913                                 

Gene name
RCHY1
Definition
(RefSeq) ring finger and CHY zinc finger domain containing 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102350333 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102350333 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lcm04121]
    102350333 (RCHY1)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102350333 (RCHY1)
Ubiquitin system [BR:lcm04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102350333 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-RING_11
Other DBs
NCBI-GeneID: 102350333
NCBI-ProteinID: XP_006011858
Ensembl: ENSLACG00000002398
UniProt: H2ZZ59
LinkDB
Position
Un
AA seq 238 aa
MAACGLGCEHYSRSCLLKAPCCSKFYVCRLCHDAKENHEMDRFQVQEVQCAKCERVQSAQ
QNCEGCETVFGEYYCDICHLYDKDKKQYHCDQCGICRIGPQECYFHCLKCNLCLPLHLQG
NHKCIENVSRQNCSVCLEDIHTSRVGGQVLPCGHLLHSTCHQELLKTGAYRCPLCMRSTV
DMKLSWQKLDEEISETAMPPEYENMTVTIHCNDCNTQSTVKFHVLGLKCGACGSYNTS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctgcttgcgggctgggatgtgaacattatagccgaagttgtctgttaaaagctccg
tgttgcagtaaattttatgtctgccgcctttgccacgatgcaaaagaaaaccatgaaatg
gaccgctttcaagtacaagaggtgcagtgtgcaaagtgtgaaagagttcaatctgcccag
cagaactgtgagggttgtgaaacagtgtttggagagtattattgtgacatttgccacctg
tacgacaaggacaagaagcaataccattgtgatcaatgtggaatttgcaggattggcccc
caagaatgttattttcactgtttaaagtgtaatttatgtctaccccttcatctccaagga
aaccacaagtgtattgaaaacgtgtcaaggcaaaactgttcagtttgcttggaggatatc
catacttcccgtgtaggcggacaggttttgccttgtggacaccttcttcacagcacttgt
catcaggaactgttgaagacgggtgcatacaggtgtcccttgtgcatgcgttcaacggta
gatatgaaactgagctggcagaaacttgatgaggaaatttctgagacagctatgccacct
gaatatgaaaacatgactgtaacaattcattgtaatgactgcaacacacagtctaccgtc
aagtttcatgttctcggtctgaagtgcggcgcctgtggctcttacaatacatcttag

DBGET integrated database retrieval system