KEGG   Latimeria chalumnae (coelacanth): 102351315Help
Entry
102351315         CDS       T02913                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04210  Apoptosis
lcm04625  C-type lectin receptor signaling pathway
lcm04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102351315 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102351315 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102351315 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102351315 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102351315 (MAP3K14)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102351315 (MAP3K14)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: STE group
  Other
   102351315 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 102351315
NCBI-ProteinID: XP_005994658
Ensembl: ENSLACG00000009685
LinkDB All DBs
Position
Un
AA seq 934 aa AA seqDB search
MAVLGSENQGTMSPATGHHKQLSVSKMGLDFPGAEQIPDSKKKEEEESSDILHSCSAQLK
SELCKVISKGTAQPGSEESMDRKIFIITQAQCEDKQELCPSHSGSIDYSSRSDSSEHILN
NVAKESEGRVASLCNKKRRQSSCKKKYRRNKSKCKRKKSSSKEVSTIAEQESSLPVPVQE
DDYHHRTFCSNDSNDLLDACIKTKRPYYLKEPYDSSVSSTQMLNDLKIYPTSKHLGEFVP
QPEATCPYNYENDPILYQFLIPDNPLYLENFRDERCCIHAETNQLPYLPRIDAHFVRENR
VPLLLNLSLVDSSCRNNSSFGKNDSKDLSMEKMEIEALQGNVTTEDKRHINSFTKVWKKA
SQQLKEGFPVPKENEGILLHEKLKHKDYEYKENINYSRISCLGHGTFGEVYEVKDNSTGF
QCAAKTLPLENFRAEELLTLTQVKSPRIVPLLGAVREGLNITLFMEMIKGGSLGQLIKEW
GSLPEDRALYYHGQVLEALEHLHAMNVLHGDVKADNVLLSTDGKQAFLCDFGHSAQLSAT
GIDVLATGDYMPGTRTHMAPEVVKGTACDVKVDVWSSCCMMLHILNGCHPWREHNANQIF
MQIANEPPPVDEIPASCSPYTTDVIRSGLEKESVRRASASELRMKVIKALKEVGGLTNQL
KKTQKSSPVSDNSSIGLGSSQTPVSETGTGAIRELESPLIGVDMKKSITLHKKKSEIMTP
QNKHMEYSLPLPLSSVVPSISKHRSREQKKTTSDWEIEELEREFFLNSLSQPYSPEFQEQ
MLSCLRTDSPIIWDYTEKDSLKGFPSLRDDLSSGIHSWNSQTDGQSLSGNSRLYLSKYAN
TSNYFNGVDVLVQSLDGECLNIRECRRTRVGQVAVGLSAQISSSYFSLVTMDGQPVSHEM
EIPDSGINLKCTLAPDCNSEWTWRIRDGKMEKRP
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atggcggtactagggagcgaaaatcaggggactatgtccccagccacggggcaccacaaa
cagctctctgtgtccaagatgggcctagactttccaggggctgagcagattccagacagc
aagaagaaagaggaggaagaaagttcagacattctacatagctgcagtgcacagcttaag
agcgagctgtgcaaagtgattagcaaagggacggcacagccagggagcgaggaaagcatg
gaccgcaagatattcatcataacccaggcacaatgtgaggacaagcaagagttatgtcca
tcccactcaggatctattgattacagcagcaggtcagacagcagtgaacacattctaaat
aatgtggctaaggaatctgaaggaagagtggcctccctatgcaacaagaagcgacgtcag
agttcatgcaaaaagaaatatagacgaaacaaatccaaatgcaaaaggaagaaaagctct
tcaaaagaagtctcaacgattgcagaacaggaaagctctcttccagtacctgtgcaggaa
gatgactaccaccatagaaccttttgcagcaatgattcaaatgaccttcttgatgcatgc
atcaagacaaagagaccatactacttaaaggaaccatatgattcaagtgtctccagtact
caaatgctaaatgacttaaaaatatatcctaccagcaaacatttgggtgaatttgtacct
cagccagaggccacgtgcccctacaactatgaaaatgatcctatcttatatcagttcctc
attccagataaccctctgtatcttgagaattttcgggatgaaaggtgctgtatacatgca
gaaaccaaccaacttccttatttaccccgtatcgatgctcattttgttcgtgagaacagg
gtgcctttgctgctaaacttgagcctggtggacagctcatgcagaaataatagcagcttt
ggcaaaaatgattccaaagatctttctatggaaaaaatggaaatagaagcccttcagggg
aatgtgactacagaggacaaaaggcatattaacagttttaccaaagtgtggaagaaagcc
agtcagcagttgaaagaaggattcccagtcccaaaagaaaacgaaggcattcttttgcat
gagaaattaaagcataaggactatgaatacaaagaaaatattaactactccaggatctct
tgtctgggtcatggcacatttggggaggtttacgaagtaaaggacaacagcactgggttc
cagtgtgcagctaaaacattacctttagaaaacttccgtgcagaagagttgctaacatta
actcaagtgaaaagtccacgaattgttccacttcttggtgctgtgagagagggtctgaat
atcacattgtttatggagatgataaaaggaggctcactaggacagctgatcaaagagtgg
ggctctcttccagaagatagggctctctattaccatggacaggtgctagaagctttggaa
cacctacatgcaatgaatgttctacatggagacgttaaagctgacaatgtgctgttgtct
actgatgggaagcaggccttcctgtgtgactttggacactctgctcagctttcagctact
ggaatagatgtactggcaacaggtgattatatgcctggcacaaggacacacatggcgcct
gaggtggtcaagggcactgcctgtgatgtgaaggtggatgtttggagtagctgctgtatg
atgctgcacatacttaatggatgccatccttggagagaacataatgcgaaccaaattttc
atgcagattgcaaatgagccaccaccagtagatgaaatcccagccagctgtagcccttac
accactgatgtcatcagatcagggctggagaaagagtctgtgagaagggcctcagcatct
gaattgcggatgaaggttatcaaagcactgaaagaagttggtggcctgacaaatcagctc
aagaagacccaaaagtcaagtccagtcagtgataactccagtattggcttaggaagctct
caaacccctgtcagtgagactggaactggagcaattagagagttagagagccccctgatt
ggagtggacatgaagaaatctataacgcttcataaaaagaaaagtgaaattatgacccct
caaaacaagcacatggagtattctttaccactccctttatcctctgtggtaccatctatc
tccaaacaccggagcagagaacagaagaaaaccacatctgactgggaaattgaagaactg
gagagagaattcttcctgaacagcctctctcagccatactcgccagaattccaagagcag
atgttatcctgtctccgcactgacagtcccattatctgggattatactgagaaggactct
ctgaagggctttcccagcttgagggatgatctcagctccggtattcactcttggaacagc
caaacagatggacaaagcctcagtggaaatagcaggctatacctctccaagtatgccaac
acatccaactacttcaatggggtggatgtgttggttcagtcgctggatggagaatgttta
aacatccgggaatgtcgacgaacaagagtggggcaagtggcagtggggcttagtgcacag
atctcttcctcctacttcagcctagtaacaatggatgggcagcctgtgtctcatgaaatg
gagattccagactctggaattaatttgaaatgcaccctcgcccctgactgcaactctgaa
tggacatggaggattagggatggcaaaatggagaaaaggccataa

DBGET integrated database retrieval system