KEGG   Latimeria chalumnae (coelacanth): 102351325Help
Entry
102351325         CDS       T02913                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102351325 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102351325 (SOD2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102351325 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102351325
NCBI-ProteinID: XP_005998122
Ensembl: ENSLACG00000015527
LinkDB All DBs
Position
Un
AA seq 220 aa AA seqDB search
FVLSCRCTVNMAPALSCLGSRHKHSLPDLPYDYGALEPHISAEIMQLHHSKHHATYVNNL
NIAEEKYLEVLTKGDVTAQVSLQPALRFNGGGHINHTIFWTNLSPSGGGEPQGELNEAIK
RDFGSFEKMKEKLTSISVGVQGSGWGWLGFNKENGRLQLASCPNQDPLQGTTGLIPLLGI
DVWEHAYYLQYKNVRPDYLKAIWNVINWENVAERYRAAKK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
tttgttttatcttgcagatgtactgtgaatatggctccagcactgagctgcctgggctcc
agacacaagcatagtctccctgacctgccatatgactatggtgcactggaacctcacatc
agtgcagaaatcatgcagctccaccacagcaagcatcatgctacctatgtcaacaaccta
aacattgcagaggaaaagtacttggaagtactaactaagggggatgttacagctcaagtg
tctctacagcctgcacttcggttcaatggaggcggccacattaaccacaccattttctgg
accaacctttccccgagtggtggaggagaacctcaaggagagctaaatgaggctatcaag
cgagactttggctcctttgagaaaatgaaggagaagctgacttcaatatcagttggtgtt
cagggctcaggctggggatggctgggctttaacaaagagaatggacggctacagttagcc
tcttgccccaatcaggacccactgcaaggaacaacaggccttattccacttcttggaatt
gatgtctgggagcatgcctactacctacagtacaagaatgttaggcctgactacctaaaa
gctatatggaatgtgatcaactgggagaatgtagctgagagatatcgagcagccaaaaag
taa

DBGET integrated database retrieval system