KEGG   Latimeria chalumnae (coelacanth): 102351908
Entry
102351908         CDS       T02913                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04210  Apoptosis
lcm04620  Toll-like receptor signaling pathway
lcm04621  NOD-like receptor signaling pathway
lcm04622  RIG-I-like receptor signaling pathway
lcm04623  Cytosolic DNA-sensing pathway
lcm04625  C-type lectin receptor signaling pathway
lcm04920  Adipocytokine signaling pathway
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102351908 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102351908 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102351908 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102351908 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102351908 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102351908 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102351908 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102351908 (IKBKG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102351908 (IKBKG)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102351908 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102351908 (IKBKG)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102351908 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 102351908
NCBI-ProteinID: XP_014352663
LinkDB
Position
Un
AA seq 627 aa
MSLDRATPIHKMVQPSGSLRNECDMNSGGSSLGSRRPDLPLELNSQEALQRLQAENYDLR
EAMRQSNLALRERYDELLAFRARNKEEKDFMLERFKEARCLVEKLSQEKVEIQHQLEEAY
RDMEQLRTGNKHTTEDGEEAAAQGGLSKMLEDPPNNHNMDNSSPGSSPPSYNTITPSMFD
SMEVAHSDCTAERSKGMNSENEFLRLLKERKEQLEAIMVEQRQANERLQQQNAGLAKRID
ELQARLGDHNVGETSAKIQGGSQQKAADQMLMKRVVELEETLKEKETERLELTHKLEALQ
REMTQLRQSETKLRMREKEVEWTNEQKLQTLSKQIEQLTEDKASLKSQVTSLLGELKESQ
SCLENCMKEKTQLDERYRATSESLKTQEREYETQKRQHNVLVDQLRMQVQNLEPALKLER
QNASEEKRKLAQLQAAYHQLFQDYDQHIKTTMESKKRNRGMDREQFEDLKQQLQQAEEAL
VSKQEYIDKLKEEAEQSKMVLEEIPVLKAQAEIFKADFLAERQARENLHEQKERLQEQLQ
QLRAELDGASRARIEEMQQRHMEPFRAALPPQGGFAVGGNTVPFFPAQDAGRRRSIPEEQ
PDYCCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgagcctggaccgtgcgactcccatccataaaatggtgcagcccagcggcagcctgagg
aacgagtgcgacatgaacagcggcggctcctcgctgggcagccggaggcctgaccttcca
ctcgagctgaacagccaggaggcccttcagcgtctccaggcagagaactatgacctgaga
gaggcaatgcggcagagtaacctggccctgcgggagcgctatgatgagctgcttgccttc
cgagccaggaacaaagaggagaaggacttcatgctggagaggttcaaggaggcccggtgt
ctggtggagaagctgagccaggagaaagtggaaattcagcatcagctggaggaagcttac
agggacatggagcagctccggactgggaacaagcacacgactgaagatggggaggaagct
gcagcccagggaggtctaagcaaaatgctggaagacccacccaataaccacaacatggat
aactccagtccagggagctctcccccttcctataacacaatcacacccagcatgtttgac
agtatggaggtggcgcattcggactgcacggcagaaaggtcaaagggcatgaacagtgag
aatgagtttctccggctgctgaaggaacggaaggagcagttagaggccatcatggtggag
cagcgccaggcaaatgagaggctccagcagcagaacgctggcctcgccaagcggattgat
gaactgcaggcacgactgggagaccacaacgttggggagacttcagccaaaatacaggga
ggctcccagcagaaagcagccgaccagatgctgatgaagagggtggtggaactggaggag
acgttaaaggaaaaggaaacggagcgcttggagctgacacacaagctggaggctctgcag
agggaaatgacccagctcaggcagtccgaaaccaaactgcggatgcgggagaaggaggtg
gaatggaccaacgagcagaaactgcaaacactcagcaaacagatcgagcaattaaccgaa
gacaaggcctcactgaagtcccaagtgacatcactactaggagaactgaaagagagtcag
agttgcctggagaactgcatgaaagagaaaacacagctggatgaacggtaccgagcaacg
agcgagagtttaaagacgcaggagcgagagtacgagacgcagaagaggcaacacaacgtg
ttggtggatcagctacgtatgcaggtccaaaaccttgaaccagcgctaaaattggaacga
cagaacgcctccgaggaaaagaggaaactggcccagttacaagctgcctatcaccagctc
ttccaggactatgaccagcatatcaaaaccaccatggagagcaagaagaggaaccggggc
atggaccgggagcagtttgaggatctgaaacaacagctccagcaggcggaggaggctctg
gtgtccaaacaggagtacattgacaaattgaaggaagaggcagaacagagcaagatggtc
ctggaggagatcccggttttgaaagcacaggcggagatcttcaaggcagacttcctggca
gagcggcaggcacgcgagaatctgcacgagcagaaggagcgcctccaggagcagctacag
caacttcgagccgagctggatggggcatccagggcgcggattgaagaaatgcagcagcga
cacatggagcccttcagagcagctctgcctccgcaaggtggctttgcagtaggtgggaac
acagtgccattctttccagctcaggatgctggtcggaggagaagtattccagaggaacag
cccgattactgttgtcccaagtgccagtaccaggctccggatatggacacactgcagatc
cacgtcatggactgcattcagtaa

DBGET integrated database retrieval system