KEGG   Latimeria chalumnae (coelacanth): 102352198Help
Entry
102352198         CDS       T02913                                 

Gene name
CERCAM
Definition
(RefSeq) cerebral endothelial cell adhesion molecule
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00310  Lysine degradation
lcm00514  Other types of O-glycan biosynthesis
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102352198 (CERCAM)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102352198 (CERCAM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lcm01003]
    102352198 (CERCAM)
Enzymes [BR:lcm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     102352198 (CERCAM)
Glycosyltransferases [BR:lcm01003]
 O-Glycan biosynthesis
  O-linked Gal type
   102352198 (CERCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 102352198
NCBI-ProteinID: XP_005992172
Ensembl: ENSLACG00000016803
LinkDB All DBs
Position
Un
AA seq 589 aa AA seqDB search
MLGLFLWGLLVGALGYFAEERQSPESPPQSPTVVVALIARNAAHSLPYYLGALERMDYPK
DRIAIWCATDHNIDNTTAILREWLTAMQKYYHSIEWRPLEEPKSYPGELGPKHWTNGRYE
YLMKLKQAALNFARKQWADYILYMDTDNILCNRQTLRLLIAENKTLVAPMLDSQSAYSNF
WCGITPQGYYRRTAEYFPTKHRHRLGCYPVPMLHSTFLIDLRRVATKKLTFYPPHRDYSW
PFDDIIVFAFSCKVTEIQPYICNKKRYGYINVPVKPQQSLEDDHLNFVHLMVDALIEGPV
MYPSRYVYLPPRHPDKMLFDEIYLINLVRRQDRRERMLQTLYELKIDAKVVDAVDGSALN
SSDIKALGVNLLPGYYDPFSGRTLTKGEVGCFLSHYFIWKEIVDLQLERSVVFEDDVRFE
GLFKRRLMRLMEEVELVELDWDLIYLGRKLVNPSQEKEVDDVRNLVIADYSYWTLAYVIS
LQGAQKLINSQPLEKMMPVDEFLPIMYDRHPNEEYKKHFPNRNLMVYSVSPLLVYPTHYT
GDPNWVSDTETSTIWDDDSKKTDWSGSQKTLKDSTDTRHAMRSASRDEL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgttggggctctttctttgggggctgctggtcggggcgctgggttacttcgccgaggag
cgccagtccccggagtccccgccgcagagtcccaccgtagtggtggcgctgatcgcccgc
aatgcagcccactccctgccctactatctgggcgccctggagaggatggactaccccaag
gataggatcgccatctggtgtgccaccgatcacaatatcgacaacaccacagccatcctg
cgggagtggctgacagcaatgcagaaatattaccacagcatcgagtggagacccctggag
gagccaaaatcatacccaggagagctgggccccaaacactggaccaatggcagatatgag
taccttatgaagctgaagcaagcggctttgaactttgccaggaagcagtgggcagattat
atcctgtacatggacacagataacatcctgtgtaaccgccagacactccggctcttgatt
gcggagaacaagacgcttgtcgcccccatgctggattcccagtccgcctactccaacttc
tggtgtggaataaccccccagggctattaccgccggacagccgagtattttcccacaaag
caccgtcaccgtttgggctgctacccagtgcccatgctgcactccaccttcctgatagac
ctgcgccgggtggccacgaagaagctgacattttacccgcctcaccgtgactacagctgg
cctttcgacgatatcatcgtctttgctttttcttgcaaagtaacagagatacagccgtac
atctgtaacaagaagcgttacggatacattaacgtccctgtgaagccccagcagtccctg
gaagacgaccatctgaactttgttcatctcatggtggatgcattgatcgagggtcctgtg
atgtatccatcccgttacgtgtacctaccccccagacaccctgacaaaatgttgtttgat
gagatctacctgataaacctggtacgccggcaggatcggcgggagcggatgctacagaca
ctttacgagctgaagattgatgccaaggttgtagacgcggtggatggaagtgccctgaac
agcagtgatataaaggccttgggcgttaacctgctacctggctactacgaccccttctct
ggcaggacgctcaccaagggggaggttggctgtttcctcagccactacttcatctggaaa
gagattgttgacctgcagctggagaggtcagtggtgtttgaggacgacgtgcggttcgaa
ggactctttaagcgccggctcatgaggctgatggaagaggtggagttggtggagttagac
tgggacctcatctacctgggacggaagctggtgaaccccagccaggagaaggaggtggac
gacgtccgaaacctggtcatcgctgattactcctattggactctggcctatgtcatctca
ctgcagggggcgcagaagctaatcaactcccaacccctggagaagatgatgccagtggac
gaattcctccccatcatgtacgacaggcacccaaatgaggagtataagaagcatttcccc
aaccgaaacctgatggtgtattccgttagccccttgctggtctacccgactcactacaca
ggtgatccgaactgggtcagtgacacagagacctccacaatttgggatgatgactcaaaa
aaaactgactggagcgggtcccaaaagacactgaaggactcgacggacacgcgtcacgcc
atgcgctctgcatcccgggatgagctctag

DBGET integrated database retrieval system