KEGG   Latimeria chalumnae (coelacanth): 102352257Help
Entry
102352257         CDS       T02913                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00590  Arachidonic acid metabolism
lcm01100  Metabolic pathways
lcm04370  VEGF signaling pathway
lcm04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102352257 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102352257 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102352257 (PTGS2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102352257 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102352257
NCBI-ProteinID: XP_006009311
Ensembl: ENSLACG00000008168
UniProt: H3AHY9
LinkDB All DBs
Position
Un
AA seq 620 aa AA seqDB search
MDFKSRQKAFIIPTRMFIYGTLLFVCVSLSHAANPCCSNPCQNRGVCMTVGFDNYECDCT
RTGFYGKNCTTPEFWTWVKRALKPSPNTVHYILTHYKGFWNIVNSIPFLRDAIMRYVLTS
RSHLIDSPPTYNSHYDYKSWEAYSNLSYYTRTLPPVPEDCPTPMGVKGKNSLPDSKMIAE
KFLLRRKFIPDPQGTSLMFAFFAQHFTHQFFKTDQIRGPAFTTGLGHGVDLNHIYGETLD
RQHKLRLFKDGKLKYQMINGEMYPPTVKDVQVAMTYPPHIAEDFKFAVGQEVFGLVPGLM
MYSVIWLREHNRVCDILKQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKL
KFDPELLFHQQFQYQNRIAAEFNTLYHWHPLMPDSFLIQGKEYGYHQFLFNNSIVTEHGI
RNLVESFSKQIAGRVAGGRNVAPGVLRVAIASIDQSRKMRYQSLNEYRKRFQMRPYKSFE
DLTGEKEMAAELQELYGDVDAVELYPGLMVEKPRPGAIFGETMVEMGAPFSLKGLIGNPI
CSPEYWKPSTFGGNVGFQIVNTASLQKLVCSNVKGTCPFTSFHIPEPNPTKTSTSNASTS
NSALKDINPSLLLKKHSTEL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaaaagtagacaaaaggcctttatcattcctacaaggatgttcatttatgga
actttactatttgtttgcgtatctctcagccatgcagctaatccttgttgctccaaccct
tgtcagaataggggtgtatgtatgactgtaggatttgacaactatgaatgtgattgtact
agaactggattttatggaaagaattgcacaactccggaattctggacctgggtgaaaagg
gctttgaaacccagccccaatactgttcattacatcctcacacattataaaggattttgg
aacattgtgaacagtataccattcctcagagatgctatcatgcgatatgtgctaacatcc
aggtcacatttgatagacagcccacctacctacaatagtcattatgactataaaagttgg
gaagcgtactccaatctcagctattacactagaacacttccaccagttccagaggactgc
ccaactcctatgggagtcaaaggtaaaaattccctgccagattccaagatgatagcagag
aaatttctgttacggagaaagttcattcctgatcctcagggtaccagcctcatgtttgct
ttctttgctcagcattttactcaccagttcttcaaaacagaccaaatacggggccctgcc
ttcactacgggacttggacatggtgttgacctgaatcatatctatggggaaactttggac
agacagcacaagctcagactttttaaagatggaaaactgaaatatcagatgatcaatgga
gagatgtaccctcctactgttaaagatgtccaagtagccatgacttaccctccccacatt
gcagaggactttaagtttgctgtgggccaggaagtctttggcctcgtccctggactaatg
atgtattcagtaatctggcttagggagcacaacagagtttgtgacattcttaagcaggaa
catccagaatgggatgatgaacgtctgttccagacaactagactgattctaattggtgaa
accattaaaattgtgattgaagactatgtgcagcatctgagtggttatcacttcaagctg
aagttcgacccagaattgctattccaccagcagttccagtaccaaaatcggattgctgcc
gagttcaacactctgtaccactggcacccactcatgccagactcctttctgatccagggc
aaggagtatggctaccatcagttccttttcaataactcaattgtcactgaacatgggatc
agaaacctggtggagtctttttctaagcagattgctggcagggttgctggtggaaggaat
gttgcacctggagttctgagagtagctatagcttctattgaccagagcagaaagatgaga
taccaatccctgaatgagtaccgaaaacgtttccaaatgaggccttataaatcttttgag
gatctcacaggagagaaggaaatggctgcagaactccaagaactttacggagacgtagac
gctgtggagctataccccggcttaatggtagagaagcctcgccctggtgctatctttgga
gagaccatggtagaaatgggtgccccattctccttgaagggcctgataggaaatcctatc
tgctcccctgaatactggaaaccaagtacctttggcgggaatgtgggctttcagattgtg
aatactgcttccttacaaaaacttgtttgtagcaatgtaaagggcacttgcccctttacc
tcatttcacattccagagcctaatcccacaaaaactagcacaagcaatgctagcacctca
aactctgcactgaaagacatcaacccaagtttactactgaaaaaacattcaacggaatta
taa

DBGET integrated database retrieval system