KEGG   Latimeria chalumnae (coelacanth): 102352490
Entry
102352490         CDS       T02913                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04141  Protein processing in endoplasmic reticulum
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102352490 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102352490 (BAX)
   04217 Necroptosis
    102352490 (BAX)
   04115 p53 signaling pathway
    102352490 (BAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102352490 (BAX)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102352490 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcm03029]
    102352490 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcm02000]
    102352490 (BAX)
Mitochondrial biogenesis [BR:lcm03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102352490 (BAX)
Transporters [BR:lcm02000]
 Other transporters
  Pores ion channels [TC:1]
   102352490 (BAX)
SSDB
Motif
Pfam: Bcl-2 Flagellin_N
Other DBs
NCBI-GeneID: 102352490
NCBI-ProteinID: XP_005996773
Ensembl: ENSLACG00000006256
UniProt: H3ABM8
LinkDB
Position
Un
AA seq 223 aa
MADECGCEDSLGSAEAAWAAGDSSPRAQMGRRTPASNADNATEQILQTGQVLLKGFILDR
IQRGVETRCVQVTPDQLGVTEEQLSNPSFKNLANCLRQIGDELDGNQVLQREISRVKTDS
SKEVFFQVVREVFSDGKFNWGRVVALFYFACKLIIRALCENIPKIVRTIIEWTMEYLRDH
VVQWIREQGGWDSICLYVKRHNYHVTMIFLTGFLAAFLVMRFS
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcggatgagtgcggttgtgaggatagtcttggcagcgcggaggctgcctgggccgcg
ggagacagcagtccccgggctcagatggggagaaggacgcctgctagcaacgcagataat
gctacggagcagatcttacagacaggacaggtgttattaaaagggttcatcttggaccga
atccagcgtggtgtcgaaacacggtgcgtgcaagtgactccagaccagctgggagtgacg
gaggagcagctgagcaatcccagcttcaagaacttggcgaactgtctgagacaaattggg
gatgagctggatgggaaccaggtgctccaaagagagatcagccgagtgaagactgactcc
tcgaaagaagtcttctttcaggtggtgagagaggtgttctctgatgggaagttcaactgg
ggccgcgtggtggcactcttctacttcgcctgcaagctgatcatcagggctttatgcgaa
aacattcccaagatagtgcggaccatcattgagtggaccatggaatacctgcgggatcat
gttgtccagtggatccgggaacaaggaggatgggacagcatctgcttgtacgtgaagaga
cacaattaccatgtgacaatgatttttctcaccggctttttggctgcttttcttgtcatg
cggttctcctag

KEGG   Latimeria chalumnae (coelacanth): 102359041
Entry
102359041         CDS       T02913                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04141  Protein processing in endoplasmic reticulum
lcm04210  Apoptosis
lcm04217  Necroptosis
lcm05132  Salmonella infection
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102359041
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102359041
   04217 Necroptosis
    102359041
   04115 p53 signaling pathway
    102359041
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102359041
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102359041
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcm03029]
    102359041
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcm02000]
    102359041
Mitochondrial biogenesis [BR:lcm03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102359041
Transporters [BR:lcm02000]
 Other transporters
  Pores ion channels [TC:1]
   102359041
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 102359041
NCBI-ProteinID: XP_005996278
Ensembl: ENSLACG00000011168
UniProt: H3ASQ4
LinkDB
Position
Un
AA seq 208 aa
MATPVKTEGSGKEKKENQGGAGGTGDAADEQLKQQAGNVLRGFIVQLTHNDDQEIHLRPE
DLGGSQNDIENPKTKEIVNNLIKIGDELNKNVELQRMIENVPIGSAQEVFFQVAQSLFAG
GINWGRIVALFYFTSKLVLKAITTNLREIITTIVNWTLDFIVQNVIRWVREQGGWENVRN
NFYSMNWQNVAFFAAGVLTGVLAFWKLT
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcaactcccgttaaaacggaggggtccggaaaagagaagaaagaaaaccaaggtggt
gctggaggcactggagacgcagcagatgagcagctaaagcagcaagcaggaaacgtctta
cgtggatttatagtacagttgactcataatgatgaccaagaaatccatctcaggccagag
gaccttggtggctctcagaacgatatagaaaacccaaagacaaaggagattgttaacaat
ttaattaaaattggagatgagcttaataagaatgttgaattgcagaggatgattgaaaat
gttcccattgggtctgctcaggaagtgttttttcaagtagcacaaagcctatttgctggg
ggcattaactggggaaggatcgttgcccttttctactttacctccaaacttgtacttaag
gcaataacaaccaaccttagagaaataataacaaccatagtcaactggacattggatttc
attgtacaaaatgtaatacggtgggttcgtgaacaaggaggatgggaaaatgttcgcaat
aacttctactctatgaactggcagaatgtggcgttctttgcagcgggagtccttaccgga
gttttggctttctggaaactgacttaa

DBGET integrated database retrieval system