KEGG   Latimeria chalumnae (coelacanth): 102352894
Entry
102352894         CDS       T02913                                 

Gene name
SHISA5
Definition
(RefSeq) shisa family member 5
  KO
K10135  scotin
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102352894 (SHISA5)
SSDB
Motif
Pfam: Shisa Comm EphA2_TM DUF4064 SARAF ECSCR
Other DBs
NCBI-GeneID: 102352894
NCBI-ProteinID: XP_005987107
LinkDB
Position
Un
AA seq 317 aa
MESETSSEKLMIIGVILSIIIVVFVCCCFCMTRMCKAQTESATSTQLTSLAPTASFEAYI
QQDYSAPTYPGYQPAPNQLAPADPTATMTPSLPEFTPPALQISEPPSPPPTYEEVLATFA
GDDCEAYRDRSGKFYLKQDCSFFYFCCGTCENRYCCSSYEKKLSEDKQTWCEVSSNNFGT
VVAVGVTLFVLFIVIVVLCFTCSCCCLYKACRSPPQRIIATPATTTTVIHAPYPQQSVGP
QAYPAGPYQGYQPVPFQPSPAMPTAPYPAQYPPAYPANVSGPPPPYQEMVPTGTGAAYPP
PQLPYNPAYMEPQKPAY
NT seq 954 nt   +upstreamnt  +downstreamnt
atggaatctgagaccagctcagaaaagctcatgataatcggagtcatcttaagtattata
atagttgtcttcgtttgttgctgcttttgtatgacaagaatgtgcaaagcccaaactgag
tctgcaacatctacacagcttacaagtctggctcccactgcatcatttgaggcatacata
cagcaggattactctgcaccaacctatccaggataccaacctgccccaaaccagcttgct
cctgcagacccaacagcaacaatgactccttctctgcctgagtttacaccacctgcactg
cagatatctgagccgccttcgcccccgcccacttatgaagaggttttggcaacctttgcc
ggtgacgactgtgaggcataccgtgaccgaagtggaaagttctaccttaaacaagattgt
agttttttctatttttgctgtgggacctgtgagaaccgttattgctgcagtagctacgag
aagaaattatccgaggacaagcagacctggtgtgaagtatcttctaacaactttgggaca
gtcgttgctgtaggagtgaccctctttgtgctctttatcgttattgtcgtcctgtgtttt
acctgttcatgctgttgtttatataaagcgtgcagaagcccaccacagcgtattatagca
accccagctaccactacaacagtgatccatgctccatatcctcagcagtcagtgggacct
caagcttatccagcaggaccataccagggatatcaacctgtaccattccagccatctcca
gctatgccaacagcaccatacccagcacagtaccccccagcctacccagcaaatgtttca
ggacctccacctccataccaagagatggttcctactggtacaggagcagcatacccaccg
cctcagcttccctacaaccctgcctacatggagccacaaaaacctgcttattga

DBGET integrated database retrieval system