KEGG   Latimeria chalumnae (coelacanth): 102353479Help
Entry
102353479         CDS       T02913                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102353479 (GADD45G)
   04068 FoxO signaling pathway
    102353479 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102353479 (GADD45G)
   04210 Apoptosis
    102353479 (GADD45G)
   04115 p53 signaling pathway
    102353479 (GADD45G)
   04218 Cellular senescence
    102353479 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcm03036]
    102353479 (GADD45G)
Chromosome and associated proteins [BR:lcm03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102353479 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102353479 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae DUF4359
Motif
Other DBs
NCBI-GeneID: 102353479
NCBI-ProteinID: XP_006003020
Ensembl: ENSLACG00000004429
UniProt: H3A5R0
LinkDB All DBs
Position
Un
AA seq 160 aa AA seqDB search
MTLEEVHGQESTIENADRMLCAGKALEEMLMSAQTQECLTVGVYESAKVMNVDPDSVAFC
VLAVDEEEEGDIALQIHFTLIQAFCCENDINIVRVHDIQKLAEIVGSSDESGEPKDLHCI
LITNPNEDSWKDPALEKLSLFCEESRCDNEWVPTISLPER
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagttcacggacaggaaagcaccattgaaaacgctgacaggatgctg
tgtgctgggaaagctctggaggaaatgctgatgtcggctcagacacaggaatgtttgact
gttggtgtctacgagtctgcaaaagtcatgaatgttgatccagacagtgtggctttttgc
gtgctggcagtggatgaggaggaggaaggcgatatcgccctgcagattcacttcaccctg
atccaagctttctgttgcgaaaacgacatcaacatcgtgagggtgcatgacatccagaaa
ctggccgagattgtgggtagctcggacgaatcgggggaaccgaaagacctgcactgcatt
ctgatcacgaatccaaatgaagattcgtggaaggacccagccttggaaaagcttagcctg
ttctgcgaggaaagccgctgtgacaatgagtgggtgcccaccatttcacttcccgagcga
tga

DBGET integrated database retrieval system