KEGG   Latimeria chalumnae (coelacanth): 102353660
Entry
102353660         CDS       T02913                                 

Gene name
CDK6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102353660 (CDK6)
   04115 p53 signaling pathway
    102353660 (CDK6)
   04218 Cellular senescence
    102353660 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102353660 (CDK6)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102353660 (CDK6)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102353660 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 102353660
NCBI-ProteinID: XP_006002683
Ensembl: ENSLACG00000004106
LinkDB
Position
Un
AA seq 323 aa
MDKDSLAQLYEPVAEIGEGAYGKVYKARDLKNGGRFVALKKVRVQTGEEGMPLSTIREVA
VLRQLESFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKAPEPGVPPETIK
DMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPIFRGNSDVDQLGKILDVIGLPEDEDW
PCDVSLPRNAFTPRPPQPIEKFVPDIDELGKDLLLKFLTFNPTKRISSYKSLSHPYFCDL
EKCSENLDSHLSSRQLSTEENTA
NT seq 972 nt   +upstreamnt  +downstreamnt
atggataaagacagcctcgctcagctgtacgaacccgtggctgagattggggaaggagcc
tatgggaaggtgtacaaggcccgggatctgaagaatgggggccgcttcgtggcgctgaag
aaggtgcgggtgcagactggggaggaggggatgccgctctccaccatccgcgaggtggca
gtgctgaggcagctggagtccttcgagcaccccaacgtggtcaggttatttgatgtgtgt
acggtgtctcgaacagatcgggaaacgaaactgacactggtctttgagcacgtggatcaa
gatttgaccacttatttggagaaagctcccgagcctggtgtgccccctgaaactataaag
gatatgatgtttcagcttcttcgaggtctggatttccttcattcacacagagtggtgcat
cgggacctgaagccccagaatatcctcgtgaccagcagtggtcagatcaagctcgctgac
tttggtctagcacgcatctacagttttcagatggcgcttacgtcagtggttgtcactttg
tggtatcgggcaccagaagtcttgcttcagtctagttatgcaacaccagttgacctctgg
agtgttggctgtatatttgccgaaatgttccgacgaaggccaatttttcgtggaaattca
gatgttgatcagctgggaaaaatccttgatgtaattggtctccctgaagatgaagactgg
ccctgtgatgtgtctcttccaaggaatgcttttaccccaagacctccacaacccattgaa
aaatttgtaccagatatcgatgaattaggaaaagatttactgcttaaatttttgaccttc
aacccaacaaaaagaatatcttcatataaatctctttctcatccatacttctgtgacctt
gaaaaatgcagtgagaaccttgactctcatttgtcttcaagacagctttctactgaggag
aatacagcctaa

KEGG   Latimeria chalumnae (coelacanth): 102363370
Entry
102363370         CDS       T02913                                 

Gene name
CDK4
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
lcm04530  Tight junction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102363370 (CDK4)
   04115 p53 signaling pathway
    102363370 (CDK4)
   04218 Cellular senescence
    102363370 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102363370 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102363370 (CDK4)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102363370 (CDK4)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102363370 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 102363370
NCBI-ProteinID: XP_006011435
Ensembl: ENSLACG00000005150
UniProt: H3A830
LinkDB
Position
Un
AA seq 306 aa
MASEVKTLYEPVAKIGGGAYGTVYKARDLQSGKFVALKSVKVHTTEEGLPLSTVREVALL
KRLEHFDHPNIVRLMDVCATTRTDSELRVTLVFEHVDQDLRTYLEKAPNPGVPADTIKDL
MRQFLKGLEFLHLNCVVHRDLKPENILVTSRGEVKLADFGLARTYSCHMALTPVVVTLWY
RSPEVLLHLPYATSVDMWSAGCIFAEMFRRKPLFCGNSEVDQLGKVFDMIGLPPEEEWPR
EVVLPYSSFTQRLPQPFRMFVPEIDEFGGSLLLEMLTFSPDKRISAFNALQHPYFKDHGA
EGIRTN
NT seq 921 nt   +upstreamnt  +downstreamnt
atggctagtgaagtcaaaactctttacgagcctgtagctaagattggaggaggagcatat
ggtacagtttataaagcaagagatctacagagtggaaaatttgtggctcttaaaagtgtc
aaagtacacacaactgaagaaggactaccgctgtccacagtccgagaagttgctctgctg
aaacgattggaacattttgatcacccaaatattgtccggctcatggatgtctgtgcaaca
acaagaactgacagtgaactgagggtgacattggtgtttgaacatgtggatcaggacctc
aggacttacttagaaaaagcgccaaatcctggagtacctgctgacaccatcaaggacctc
atgcgccagttcttgaagggcctggaattcctccatctaaattgtgtggtgcatcgggac
ctgaagccagagaacatcttggtaacaagtcgaggggaggttaagctagcggattttgga
ttggctcgaacttacagctgtcacatggctctcaccccggtggtagtgacgttgtggtac
cggtccccagaagtgctccttcacttgccttatgctacctctgttgatatgtggagtgct
ggttgcatatttgcagaaatgtttaggagaaagcctttgttttgtgggaattccgaagtt
gaccaattaggcaaggtctttgacatgattggcctaccaccagaggaggaatggcctcga
gaagtggtgttgccatactcttcctttacccaacgcttaccacagccctttaggatgttt
gtacctgaaattgatgagtttggaggaagtctactcctggagatgttaactttcagccct
gataaaaggatttctgccttcaatgccctgcagcacccgtatttcaaggaccatggagct
gagggcataagaaccaattag

KEGG   Latimeria chalumnae (coelacanth): 102366718
Entry
102366718         CDS       T02913                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102366718
   04115 p53 signaling pathway
    102366718
   04218 Cellular senescence
    102366718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102366718
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102366718
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CMGC group
  CDK family
   102366718
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Haspin_kinase Kinase-like YrbL-PhoP_reg RIO1
Other DBs
NCBI-GeneID: 102366718
NCBI-ProteinID: XP_006003325
Ensembl: ENSLACG00000012491
LinkDB
Position
Un
AA seq 301 aa
MNDWCSSLNYELQAVIGEGAYGKVYKARDLDGRFVALKKMNLFSNEDGVPFSVIREVGIL
KKLEFFEHPNIVRLFDVSIFQSGREIQLVLVFEHVDQDLSTFLSKVPEPGLPVEKIKDLM
EQLLRGIDFLHTNHVIHRDLKPENILINSKGQIKVADFGLARLYSFHMALTPVVVTLWYR
APEVLLCSSYETSVDMWSIGCIFAELYQRKPLICGYSDISQLQKMFDLLGLPEEAEWPQE
APIPYSAFTRNSARGIEDVPSGIDNEGKDLLLKCFCFDPKRRISALEALAHPYFKMVTGE
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaatgactggtgttctagtttaaattacgagctccaggctgtgattggagaaggtgcc
tatggtaaagtttacaaagcacgagacttggacggaaggtttgtggcactgaagaaaatg
aatcttttctcgaatgaggatggagtccctttctcggtgattcgagaggtgggaattctg
aaaaaactggaattctttgaacatccaaatattgttaggttgtttgatgtgtccattttc
cagagtggaagggaaatacagttggtgttggtgtttgagcacgttgatcaagatctgtca
acttttctgtcaaaagttcctgaaccggggctacctgttgaaaagataaaggacctgatg
gaacagttgcttcggggtattgattttctccataccaatcacgtgattcatcgagacttg
aaacctgagaacatccttattaacagtaaaggtcaaattaaagtagctgactttggtctg
gccagactttacagcttccacatggcactaaccccagtggtggtcactttgtggtatcgt
gcaccagaggtcttactgtgttccagttatgaaacgtctgttgatatgtggagtattgga
tgcatttttgcagagctttatcaacgaaagccattgatatgtggatactctgatatcagt
cagctccaaaaaatgtttgatttgttaggcttgcctgaagaagctgagtggcctcaggag
gcaccgataccctacagcgcgtttacaaggaattctgcgagaggaattgaagatgttcca
tccggtatagataatgaaggaaaggacctgcttcttaaatgtttctgttttgaccctaaa
agaaggatctctgctttggaagctttggcacatccctatttcaagatggttaccggagaa
ctatga

DBGET integrated database retrieval system