KEGG   Latimeria chalumnae (coelacanth): 102353753
Entry
102353753         CDS       T02913                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04020  Calcium signaling pathway
lcm04144  Endocytosis
lcm04510  Focal adhesion
lcm04540  Gap junction
lcm04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102353753 (PDGFRA)
   04020 Calcium signaling pathway
    102353753 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102353753 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102353753 (PDGFRA)
   04540 Gap junction
    102353753 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102353753 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102353753 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lcm04090]
    102353753 (PDGFRA)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102353753 (PDGFRA)
Protein kinases [BR:lcm01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102353753 (PDGFRA)
CD molecules [BR:lcm04090]
 Proteins
  102353753 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set Adeno_E3_CR1 C1-set Kinase-like
Other DBs
NCBI-GeneID: 102353753
NCBI-ProteinID: XP_014351399
LinkDB
Position
Un
AA seq 821 aa
MEIEGTEIYVYVPDPTVVFVPIKQYEEFIFAPEGELVTIPCRITDPTLSVTLRNLDLNEV
IHGLYDSKQGFIGKFLPGPYTCEVTINGTDIEFETQFLVQTWKAAPDLHVEVTTTKTVLK
AGESITVTCVVTENEMVHQNWIYPGEAKERGEKSYEESKNPMKLVYTLIIPNATVKDTGV
YECVVKHVKDDVKEVKHVDIIVHDKGFIELEPMFGPMEFTDLHEVKQFAVNIHAYPPPGV
TWKKNDLTPIEELTEISTATKKINEVRYQSNLTLIRAKEEDKGEYTIVVYNEDATQNYTF
LVMVKVPSLILDLNLENHHGSESGQSVLCKTGGVPMPDVEWTICKDIVKCANDTSLWTVL
PMNSTETKIEETYFDDKNEMESKVTFQKLEETMIARCIARNELATVTRELKLVAHPLRSE
LTVAAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIEPISPNGHEYIYVDPMQLPYDS
RWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSE
LKIMTHLGPHLNILNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFFCRHPDKMKKD
LDIFGINPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKDSSKYSDIQRSMYDH
PPSHKKKSLTESEVKSLLSDDNSEGLSFMDLLSFTYQVARGMEFLASKNCVHRDLAARNV
LLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGIL
LWEIFSLGGTPYPGMMVDSSFYNKIKSGYRMTKPEHATSEV
NT seq 2466 nt   +upstreamnt  +downstreamnt
atggagattgagggaacggagatttatgtttatgtcccagatccaactgttgtctttgtt
cccattaaacaatatgaggaattcatatttgctccagagggggaacttgtcactatacca
tgtcgtatcactgacccaactctttctgtcaccttaagaaaccttgaccttaatgaggtg
attcatggtctctatgacagcaagcaaggcttcattgggaagtttctgccagggccatac
acttgtgaagtaaccatcaatggcacagatattgaatttgaaacacaatttcttgtacaa
acatggaaagctgcaccagaccttcatgttgaagtgacgaccaccaaaacagtcctgaaa
gcaggcgagagcatcacggtcacatgtgttgtcactgagaatgaaatggttcatcaaaac
tggatctacccaggagaagcgaaagaaagaggagaaaaaagttatgaggaaagcaaaaat
ccgatgaaactggtgtatactctaattattccaaatgcaactgtgaaagacactggagtt
tatgaatgcgttgtcaaacatgtaaaagatgatgtcaaagaagtaaaacacgtggatatt
atagtacatgataagggattcattgaacttgaacctatgtttggaccaatggagtttaca
gatttgcatgaagtgaagcagtttgcagtcaatatacatgcttacccacctccaggggtc
acgtggaagaagaatgacttgacaccaatcgaagagctaacagaaatttcaactgctaca
aagaaaataaatgaagtcaggtatcaaagtaacctaacgctgattcgtgcaaaagaagaa
gacaaaggggagtatacaattgtggtttacaatgaagatgcaactcaaaactatactttt
ctagtcatggttaaagttccctctttaattcttgacttaaatcttgaaaaccaccatggc
tcagagagcgggcagtcagtgctgtgtaagacaggaggtgtacctatgcctgatgtggaa
tggaccatttgcaaagacattgtaaagtgtgcaaatgacacatcattgtggacagtactt
ccaatgaattccactgaaaccaaaattgaagaaacctattttgatgataaaaatgaaatg
gaaagcaaggtgacttttcagaaactggaagaaaccatgattgctcgatgtattgcaaga
aatgaacttgcgactgtgacaagagaactgaaactagttgctcaccccttgcgttctgaa
ttgactgtggcagctgcagtcttggttctactggtcattgttatcatttccctcatagtt
cttgtcattatttggaaacagaaacccaggtatgagatcagatggagagtcattgaaccc
attagccctaatggacatgaatacatttacgtagaccctatgcagttaccatatgattcc
agatgggaatttcctagagatgggcttgttcttggtcggatccttggctctggggctttt
ggcaaagtggttgaaggaactgcctatgggttaagtcgctcccagccagtaatgaaagtt
gctgtgaaaatgttaaagcccacagcgagatccagtgagaaacaggccctgatgtctgaa
ctcaaaataatgactcatttgggacctcatctgaacattcttaacctgttaggtgcttgc
acaaaatcaggcccaatatacattattactgaatattgcttctatggtgatcttgtcaac
tacttgcacaagaacagggacaacttcttttgccgacaccctgacaaaatgaagaaggat
cttgatatatttggcatcaatccagctgatgaaagcactagaagttatgttatattgtca
tttgaaaacaatggagactacatggatatgaagcaagcagatacaacacaatatgtacca
atgctggagagaaaggatagttccaagtattcagatatccaaagatcaatgtatgaccac
cctccatctcacaaaaagaaatcattgacagaatcagaagtcaaaagtctgctctctgat
gacaactctgaaggacttagttttatggacttgttgagtttcacttaccaggtagcacga
gggatggaattcttggcttctaaaaattgtgtgcatcgtgacttggcagctcgtaacgtt
ctcctggcacaaggaaagatagtgaaaatctgtgattttggtctggctagggacattatg
catgactccaactatgtctctaaaggcagcacttttcttcctgtgaaatggatggcaccc
gagagcatttttgacaacctgtacacaacactgagtgatgtatggtcttatggcattttg
ctgtgggaaatcttttctcttgggggaacaccatacccaggaatgatggttgattccagc
ttttacaacaaaattaaaagtggttacagaatgacaaaacctgaacatgcaaccagtgaa
gtgtaa

DBGET integrated database retrieval system