KEGG   Latimeria chalumnae (coelacanth): 102353921
Entry
102353921         CDS       T02913                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04120  Ubiquitin mediated proteolysis
lcm04144  Endocytosis
lcm04218  Cellular senescence
lcm04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102353921 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102353921 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102353921 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102353921 (MDM2)
   04115 p53 signaling pathway
    102353921 (MDM2)
   04218 Cellular senescence
    102353921 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102353921 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcm04131]
    102353921 (MDM2)
   04121 Ubiquitin system [BR:lcm04121]
    102353921 (MDM2)
Enzymes [BR:lcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102353921 (MDM2)
Membrane trafficking [BR:lcm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102353921 (MDM2)
Ubiquitin system [BR:lcm04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102353921 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 102353921
NCBI-ProteinID: XP_014350442
Ensembl: ENSLACG00000010207
LinkDB
Position
Un
AA seq 475 aa
MSTETADCFNSSQITASEQEALVKPKQLLLKLLKCAGAQKDIFTMKEVIYYLGQYIMAKQ
LYDKNQQHIVHCSNDLLGELFGVQSFSVKEPRRLYAMISKNLLPVNQDAVGIHVSMKETR
CHRGSETGVKDNTQEVAGEKPAAPVTASCSTTSCRRTFSETEDAVSDDPLSERRRKRHKS
DSISLTFDDSLSWCVISGLRRDRSSSESTESPSNPDSDVVSVSENSKDSWFDQDSDSDHF
SVEFEVESVYSENYSDNEEAQDVTDEDDEFYQVTIYEAEDSDDSFTEDTEISVADYWTCT
ECEEVNPPLPRHCNRCWALRKDWLPENTKSSSCKSLDLKEPDREEGIDVPDCKKTKEDPS
CDSNVDVNEEDMTVQSSESQETNISQPSTSSSFIGGSQEESRETEREESSESTLPLTCLE
PCVICQSRPKNGCIVHGRTGHLMACYTCAKKLKRRNKPCPVCRQPIQMVVLTYFS
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtctacagaaactgcggattgctttaactcttctcagataacagcttcagagcaagaa
gcattggtcaaaccaaaacagttactgctgaagttgttaaaatgtgctggtgcacaaaaa
gatattttcacaatgaaggaggtcatctactaccttggtcaatatattatggccaagcaa
ttgtatgacaagaaccaacagcatattgtccattgttcaaatgatcttctgggagaactc
ttcggagtgcagagcttttctgtaaaagaaccgagacgattgtatgcaatgatttccaaa
aacttgctccctgtcaatcaagatgccgtaggcattcatgtttccatgaaggagaccaga
tgtcatcgtggaagtgagactggtgtaaaggataacacacaggaggtagctggagaaaag
cctgcagcacctgttacagcatcttgttcaaccacctcctgtaggagaacgtttagtgaa
acagaagatgctgtttcagatgatccgctgtctgagcggcggaggaaacgacacaagtct
gacagcatctccctcactttcgatgatagcttatcttggtgtgtaataagtggcctacgg
cgtgatcgcagcagtagtgaatcaacggagtccccttctaatcctgatagtgatgtagtc
tctgtgagtgaaaactcgaaggacagctggtttgaccaggattctgactctgaccacttc
agcgtcgagtttgaggtggagtctgtctattccgaaaattacagtgacaatgaagaagca
caagatgtcacagatgaagatgatgagttttatcaggtcaccatctatgaggcagaagac
agtgatgattctttcacagaagatactgaaatatcagtcgctgactattggacatgcact
gaatgtgaagaagtcaaccctcctcttcctcgacactgcaatcgatgctgggctctccgc
aaggactggcttcctgagaatactaaatcttcgagttgtaagtcactggacttaaaagaa
ccagatcgagaggagggcatcgacgtcccagactgcaaaaagaccaaggaagatccttct
tgtgactcaaacgtggatgtaaatgaagaagacatgacagtgcaatcctcggagtcgcag
gagaccaatatttcccagccgtctacgtcgagcagtttcattggtggcagccaagaggag
tccagagagactgagcgagaggagagctcggagagcacgcttcctctgacgtgcttggag
ccctgcgtcatctgtcagagcagacccaaaaatggctgcatcgtccatggcaggacgggc
cacctgatggcttgttatacgtgtgcaaagaagttaaaaaggcgaaacaaaccttgtcca
gtctgcaggcagccaatccaaatggttgtgctaacttactttagttag

DBGET integrated database retrieval system