KEGG   Latimeria chalumnae (coelacanth): 102354325
Entry
102354325         CDS       T02913                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102354325 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lcm03000]
    102354325 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:lcm03310]
    102354325 (NR3C1)
Transcription factors [BR:lcm03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102354325 (NR3C1)
Nuclear receptors [BR:lcm03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102354325 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 TTKRSYEDQ
Other DBs
NCBI-GeneID: 102354325
NCBI-ProteinID: XP_005996162
Ensembl: ENSLACG00000015535
UniProt: H3B6W7
LinkDB
Position
Un
AA seq 770 aa
MMESKEVLNTSGGDSLKCVDYSKREEVYDFNPVFRGGAPIPLTPASSLLLVSEADSPRQL
ASGDTSNGVSGNATPQDLSQAVSESMGLYMGESDSKVIGQKARLQKQGQISGLSVETEFA
LLEESIASLNRSTRIGEVSGSLAPGQVSLDNGSGMAKCDLSVEQETFAQTDSDPNGNLSF
FPDDQAAFDILQELDLTPCSPGKENPWSLDPIYDGGGRGLLSPLAADDPFLMAAVANEDC
KSSLVTNTSQSTNNECGNLFIPDLSSQLSQIKSDKEGYIELLTPGVVKQETLGRSYCQAN
LTSAASTTANSSISIHGVNTSGGQMYHYDVNAGAVSSAQQPDQKPIFNFIPPVSTIAENW
NRCQGSGATNSTPPLGNVNASGRSGFASSYPSPGTRTATPTPSSSSTSSGPPHKICLVCS
DEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAG
MNLEARKSKKLNKMKGNLSSKEQATPPLPERAVVPASVPQLTPTMISLLEAIEPSILYSG
YDSTIPDTHCRLMTALNKLGGRQVVAAVKWAKALPGFRSLHLDDQMVLLQYSWMFLMAFG
LGWRSYQQANGSMLCFAPDLIINEQRMQLPYMYEQCQHMLKIASEFSRLQVSYEEYLCMK
ALLLLSTIPQEGLKSQPVFDEIRMTYIKELGKAIVKKEGNSNQNWQRFYQLTKLLDSMHD
VVKELLKICFHTFVDKSLSVEFPEMLAEIISNQLPKVTSGSCKALLFHQN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatggagtccaaagaagttttaaatacaagtggaggggacagcctgaaatgtgtggat
tacagtaagagggaggaggtgtatgactttaacccagtttttaggggcggggctcccatc
cctctcacgcccgcctcctccttgctcttggtttccgaagcagactccccacggcagctg
gcatctggtgacacttccaatggggtaagcggcaatgctactccacaggacctttctcag
gctgtctctgagtccatggggctttacatgggggagtccgattcgaaagtgataggccag
aaggcgaggttgcaaaagcagggccagatcagcggtcttagtgtggaaacggagtttgcc
ctcttggaggagagcatcgcaagtttgaatcggtccacaaggatcggagaggtctcggga
agccttgcacctggacaagtgtcccttgacaacggttcaggtatggccaagtgcgacctt
tccgtcgaacaagagacttttgcgcaaactgacagcgacccaaatggtaatctgagtttc
tttcccgatgatcaagccgcgtttgacattttacaggaactggatttaaccccatgttca
ccgggcaaagagaacccatggagcttggaccccatctatgatgggggtggaaggggcttg
ctgtcacctttagctgctgatgacccgtttttgatggcagcagttgcaaatgaagactgc
aagtcgtcccttgttacaaatacaagccaatcgacgaataacgagtgtggcaatctgttc
attcccgacctgagttctcaattatcccagatcaaaagtgataaagaaggttatattgaa
ctgctcacccctggggtggtcaaacaggagaccttgggaagaagctactgtcaggcaaat
cttacttcagcagcttccacgactgcaaatagttccatttcgatccacggagtgaacact
tctggtggacagatgtaccattatgatgtgaatgcaggggcagtctccagcgctcagcaa
ccggatcagaagccgatttttaatttcattccacctgtttcgaccattgctgaaaattgg
aataggtgccagggatctggggccactaactcgactccccccctggggaatgtgaatgct
tctgggagatcgggcttcgctagcagctatccaagccctggaacaagaacagcaactcca
actccctccagttcctccacatcctcaggaccacctcacaaaatctgcctggtttgctca
gatgaagcatctggctgccattatggtgttctaacctgtggcagctgcaaagtgtttttt
aaaagagcagtagaaggacagcacaattacctttgtgcaggaaggaacgactgtatcatc
gacaagattcgcaggaaaaactgtcctgcttgtcgttttcgcaaatgtcttcaggctgga
atgaacttggaagcccggaaatcaaagaaattgaacaagatgaaaggaaatctaagttcc
aaagagcaagcaacaccacctttaccagaaagagctgtggttcccgcctctgtgccacag
ttaactccgacaatgatctcattactggaggccattgagccaagtatcttgtactctgga
tatgacagcacaataccagacacccactgccgccttatgactgctctcaacaagttaggt
ggacgccaagtggttgcagcagtgaagtgggcgaaggcattaccaggcttcagaagttta
caccttgatgaccaaatggtcttgctccagtactcctggatgttcctcatggcttttggc
ttaggatggagatcttaccaacaggccaatggaagcatgttgtgttttgctccagatcta
attattaatgagcagcgcatgcagctaccctacatgtatgaacagtgtcagcacatgctg
aagattgcatctgagttttcacgcctccaggtttcatatgaggaatacctctgcatgaag
gcactcctcctactcagtacaattcctcaggaaggactgaagagtcaaccagtctttgat
gaaattcgaatgacctacatcaaagagctgggaaaggccatagtgaagaaagagggaaac
tccaaccaaaattggcagcgattttatcaacttacaaaattgctggactcaatgcatgac
gtggtgaaagagcttttaaagatttgcttccatacatttgtggataagtcgctgagtgta
gagtttccagaaatgctggcagaaatcatcagcaaccagttaccaaaagttacaagtggg
agttgtaaagcacttctctttcatcaaaactga

DBGET integrated database retrieval system