KEGG   Latimeria chalumnae (coelacanth): 102354448Help
Entry
102354448         CDS       T02913                                 

Gene name
AOC1
Definition
(RefSeq) amine oxidase, copper containing 1
  KO
K11182  diamine oxidase [EC:1.4.3.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00330  Arginine and proline metabolism
lcm00340  Histidine metabolism
lcm00380  Tryptophan metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102354448 (AOC1)
   00340 Histidine metabolism
    102354448 (AOC1)
   00380 Tryptophan metabolism
    102354448 (AOC1)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     102354448 (AOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Motif
Other DBs
NCBI-GeneID: 102354448
NCBI-ProteinID: XP_014348122
Ensembl: ENSLACG00000011748
UniProt: H3AUM1
LinkDB All DBs
Position
Un
AA seq 746 aa AA seqDB search
MKTMWNSLIWLSTLCYVINSASGHMSSSNGLNKASLFADLTAAEMKNVYDFMLSQKELCL
STSKMETLATNTVFMIELHLPKKRHALRFLDRNDLRPRRQARVVVFFGDQPHPNVTEYVV
GPLPYPYYYLPRGFKGNPPITFESRPVSGPEYFHLSKKIHEITEKAYIILKETSGFWYHN
CTDRCLTFSDIAPRGLASGERRSWIILQRSVEGFFIHPIGFEMLINHKSPNPKEWTVEKI
WYNGQYFDSVDELVEKYNKGLVKKIKLSDYTKDDLFSTYIPRGEFKTQTNIHGPKLFEPQ
GKRYRVDGNYVQYTGWSFAFRVRSSAGIQLFDIKFNDERIAYEIALQEAIAFYGGNTPAG
MQTKYIDAGWGMGIVGYELAKGIDCPEIATYLDTYNFYDTDKPVRIQNAICIFEQTTAVP
LRRHFNSNFKGGYNFFGALENHVLVLRTTSTVFNYDYIWDFIFYQNGVMEVKVHATGYIH
ATFFTPEGTHYGSKVYDHVLGNIHTHLVNYKVDLDIAGRENSFETLEVKHENITNPWSPE
HFVVQPRLHRTRREREQDASFPFRKPLPKYLIFYNPNKENKWSNKRGYRIQFNSHADQVL
PKGWKEEKGITWGRYHVAVTCHKEKEITSSSIYTQNDPWKPVVYFEDYLRDNQNIINQDL
VAWVTVGFLHIPHSEDIPNTATPGNGVGFFLRPFNFFDEDPSLASRSTVIVRPKDETFSE
VEIQRWTPAVVGKCLSETPFYYNGTY
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatgtggaattctttgatttggctttccacactctgctatgtgatcaatagt
gcttcgggtcatatgtcctcaagcaatggcctcaataaggcctctctgtttgctgacctt
accgcagccgagatgaagaatgtgtatgacttcatgttgtctcaaaaggagctctgcctc
tctacctccaaaatggaaacattggccacaaacactgtttttatgattgagctccacctg
cctaagaaacgccatgctttaagattccttgacagaaatgacttgcgcccaaggcgacaa
gctcgggtagttgttttctttggagatcagccacatcctaatgtaactgaatatgtagtg
ggcccactaccttacccatactattatcttcctcgaggatttaaaggaaaccccccaatt
acatttgagtccaggccagtttccggaccagagtattttcatctttccaagaaaatccat
gagattaccgagaaggcctatattattctgaaagagactagtggcttttggtatcacaac
tgcactgaccgctgcctaacattttcagacattgcacccagaggtcttgcatctggggaa
aggaggtcatggatcatactgcaacgatctgttgaaggcttctttatacacccaataggg
ttcgaaatgcttattaaccacaaatcccccaatcctaaagaatggacagtggagaaaatt
tggtacaatggacagtattttgacagtgtagacgaactggttgaaaagtacaacaaaggg
ctggtaaagaaaatcaagctgtctgattatacaaaggatgatcttttctccacctacata
ccccgcggggaattcaagacccaaaccaatatccatggaccgaagctcttcgaacctcaa
ggcaaacgatatagagttgatggaaattatgttcaatatacaggatggagctttgccttt
cgggtccggtcatctgctggcatacagctctttgatatcaagttcaatgatgagagaatt
gcctacgagattgctcttcaggaagccatagcgttttatggtggcaacaccccagctggg
atgcagacaaaatatattgatgctggctggggaatggggattgttggctatgaactggca
aaaggtatagattgtcctgagattgccacctaccttgacacttataacttctatgacacg
gacaagcccgtaagaatccaaaatgctatttgcatatttgagcaaactacagctgtccct
ctgaggagacacttcaacagtaacttcaaaggtggttacaatttctttggtgcacttgag
aatcatgtactggtcctaagaaccacttctactgttttcaactatgattatatctgggac
tttatcttctaccaaaatggagtcatggaggtcaaggttcatgccacaggctacatccat
gccaccttcttcacaccagagggaacccactatgggtctaaggtttatgatcatgtccta
ggtaacatccatacccaccttgtcaactacaaagtagatctggatattgcaggccgagaa
aatagctttgaaacactggaagtgaaacatgaaaacattaccaatccatggagcccagag
cacttcgtagtccagccacgcttgcaccgcaccaggagggagagggaacaggacgcatct
ttcccttttaggaaaccattgcccaaatatctgatcttctacaacccaaacaaggaaaac
aagtggtccaacaagcggggataccggatccagttcaactcccacgctgaccaggtgttg
cctaaaggctggaaagaggagaaggggatcacttggggaaggtatcacgtggcagtgact
tgccacaaggaaaaagaaatcacaagtagcagtatttatactcagaatgacccctggaag
ccggttgtttactttgaagactaccttcgtgacaatcagaatatcatcaatcaggacctt
gtggcctgggtgactgttggatttctacacattccccactctgaagacatacccaacact
gccactcctggcaatggtgttggcttctttttgcgcccttttaacttctttgatgaagac
ccatcgctggcatccaggagcactgtcattgtacgcccaaaggatgagacgttttctgag
gtggagattcaaagatggaccccagcagtggttgggaagtgcctgtctgagactccattc
tattacaatggaacatactag

DBGET integrated database retrieval system