KEGG   Latimeria chalumnae (coelacanth): 102354670
Entry
102354670         CDS       T02913                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04210  Apoptosis
lcm05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102354670 (APAF1)
   04115 p53 signaling pathway
    102354670 (APAF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102354670 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD WD40_like Ge1_WD40 CARD_2 Nup160 AAA_16 DUF4221 Cytochrom_D1
Other DBs
NCBI-GeneID: 102354670
NCBI-ProteinID: XP_005991378
Ensembl: ENSLACG00000012823
LinkDB
Position
Un
AA seq 1288 aa
MDEKARSCLLRHRAALERDIKTSYIIDHMISDEVLTLEEEQNVKTLSTQRDRGVRLINII
LRKDNYTYISFYNALLHEGYKDLAALLQDCIPIISPLMSNSKDDNTPYVQARLCEGGVPQ
RPVVFVTRMKLIQAIRKEVYKLQDDPGWVTVYGMAGCGKSVLAAEALRDHKFLNTCFPGG
VHWISIGKQDRAGLLVKLQNLCVRLDQDSQASQRPPLNIEEAKDRLRLLMFRKFPRSLLI
LDDVWDSWVLKAFDIQCRVLITTRDIGVTDTVTGKKYTVHVNSGLEHEKALEVLALFVNM
KVSELPTEAHIIVNECKGSPLVVSLIGALLKEFPKRWQYYLKQLQNKQFKRIRKSSSYDY
EALDEAMSISIEVLSEDRKGYYKDLSVLEKDVKVPTKVLCVLWDMETEDVEDILQVFVNK
SLLFCDRNGNSFLYYLHDLQLDFLTEQNRDHLPQLHAKMVNQYQKSYKKCPPAPIEDDCM
YWYNFLAYHMVKANMHKELYSLMFSLDWIKAKTELMGPAHLISEFVQYRHILDEENSTVR
DNFQEFLSLNGHLLVQKPLPDIVQLGLCQPSTSEVYRQARLKAEQKREKRTFYLDWVNKG
ALVSLTRLVVRPHTDTVYHACFSSDGQKIASCGADRTLQILKSETGERLLEINDHDDEVL
CCAFSPDNKLVATCTTDKKVKVWNSETGNLIKTYEEHAEQVNHCEFNNTSEKILLATCSD
DTYLKLWDINEKHCRNTLFGHEGYVNHCLFSPDDHYLASCSNDGTLKLWDVESANEWKSI
DVKELFLESEDNQNDAEVLVKCCSWSSDSARVMAAAKNIIFVFDVETSTLLTEIKMNPHS
TIYYFDFCPRSQMAAVAVSPYSVELWNIESNKRVADLRGHLSWVRSVRFSPDGSTLLSSS
DDQTVRLWETNKVHKSSVVSLKRVLDVLFHGDDVTILAPDNRKQLQLITAGFDTCQSEAQ
DSRVCCCCLSKNRQSAALGHDDGIVKGGIKSAGQALKKIGLWTLQLVTPFHCQFLAVGLE
KGTLKILTLPDFKTIRATEGHKKSVQKCQFTPDGQTLITSSDDATILLWNWQTEDFKVLQ
GHSEQVKNFKLLDNKRLLSWSFDGTVKVWDITSGEVMQDFACHDGAVLCCDVSPNGTMFS
STSADKTAKVWSFSNPVPLYVLEGHKDCVRSCRFSWNSKFLATGDDDGEIRIWKVSNGKL
LNICPKDAGNSTESKHGGWVTDLHFSPDSKILVSTGGYIKWWCVNTGEPLQTFYTNGTNL
KSIHVSPDFKTYVTIDNIGIPYILKMVE
NT seq 3867 nt   +upstreamnt  +downstreamnt
atggacgaaaaggcacggagctgtttgctgcgacatcgagcggcactggagcgagacatc
aagacttcctacatcattgatcacatgattagtgatgaagtccttactctggaagaggaa
cagaatgtgaagacactatctacacagagagatcggggagtgaggctcattaatataatc
ctgagaaaggataactacacctacatttccttctataacgctctgctccatgaagggtat
aaagaccttgctgctctccttcaagactgcattccgatcatctcccctttaatgtccaac
tcgaaggatgacaatacgccttacgttcaggcacgcctttgtgaaggaggagtacctcag
agaccagttgtgttcgtcacgcggatgaaactgatccaagcaatccgaaaagaggtgtat
aagttgcaggacgatcccggatgggtaactgtatatggaatggcaggctgtgggaagtca
gtgctagcagcagaagcactaagagatcacaagtttttgaacacttgctttcccggagga
gtgcactggatatccattgggaaacaagatcgagcaggactgctggttaaactccagaat
ctctgtgtccggttggatcaggattcccaggcctctcagaggccaccgcttaacatcgag
gaggccaaggaccgccttcgcctactaatgtttcgaaagttcccaaggtctcttctgata
ttggatgacgtttgggatagttgggtattaaaagcctttgacatacagtgtagggtactc
atcaccaccagggacattggtgtgactgatacagttacgggcaaaaaatacacagtccat
gtgaacagtgggctggaacacgagaaagcactggaagtcttagccctttttgtcaatatg
aaagtatcagaactaccaacggaggctcacattatcgttaatgaatgcaaaggatcaccc
ctggtggtttctctcatcggtgcgctgttaaaagagttccccaaacgctggcagtactat
ctcaaacagctccagaataagcaatttaaaagaataagaaagtcctcttcctatgattat
gaggcgctggatgaggcgatgtcaatcagtattgaagtattgagtgaagaccgcaagggg
tattataaagacctgtctgtccttgaaaaggatgtgaaagtcccaaccaaggtgctgtgt
gttctttgggacatggaaactgaagatgtggaagatattctgcaagtgttcgttaataag
tctttactgttctgtgatagaaatggaaattctttcctatattacctacatgatctacaa
ctcgactttctcacagagcagaaccgtgaccaccttccacaacttcatgcaaagatggtt
aatcagtatcagaagtcttacaaaaaatgtcctcctgctcctatcgaagatgattgcatg
tactggtataactttctagcttaccatatggtcaaagccaatatgcacaaggagctgtac
tccctcatgttttctttggattggattaaagcaaaaacggaactaatgggacctgctcat
cttatcagcgaatttgtacaatacagacacattctagatgaagagaatagcaccgtacgt
gataactttcaagagtttctgtctctaaatgggcaccttctggtacagaagccacttcca
gatattgtgcaattgggtctctgccagccgtccacttcagaggtttaccgacaagccaga
ttaaaagctgagcagaaacgggaaaaacgaactttctacctggattgggtaaacaaaggc
gctctggtgagtttgactcgtctagttgtgcgtcctcacacggacactgtttaccatgct
tgcttttcttcagacggacagaagatagcttcttgtggagctgacaggactttgcagatt
ttgaaaagtgagactggagagagacttctcgaaattaatgatcatgacgatgaggttctt
tgctgtgccttctctccagataacaagctcgtagccacttgtacaacagataaaaaagta
aaggtttggaattctgaaactggtaacctgattaaaacctatgaagaacacgcagagcaa
gttaaccactgtgagtttaacaacactagtgaaaaaatcctcctggcgacgtgttccgat
gacacttacctcaaattatgggatataaatgagaagcattgccgcaacaccctgtttggc
catgaggggtacgtcaatcattgtttgttttcccccgatgaccactaccttgccagctgc
tcaaacgatggaacattaaagctttgggatgtggagtctgctaatgaatggaaaagcata
gatgtcaaggaattattcctggagtctgaggataaccagaatgatgcggaggttctggtg
aagtgttgctcctggtcgtctgacagcgccagagtgatggcggccgcaaagaatatcatt
ttcgtttttgatgtggaaaccagcactttgttgacggagattaaaatgaatcctcacagt
acgatctactactttgacttctgtccccgcagtcaaatggcagcagtagctgtgtcaccc
tattctgtggagttatggaacatagaatccaataagagagtggctgacctccgtggacac
ctgagctgggtgcgcagtgtgagattttcacctgacgggtcaacactgctgtcgtcttct
gatgaccagacggttcgactttgggagactaataaagtccacaaatcctcggtcgtgtcc
cttaagcgcgtcctggacgttctgttccacggcgatgatgtaaccatcttagcacctgac
aacagaaagcaacttcagctaattacagctggttttgacacctgtcaaagtgaagctcag
gattctcgcgtctgctgttgctgcctcagtaaaaaccgtcaatcagcagcgttgggacat
gatgatgggattgttaaggggggcattaagtctgccgggcaggctctgaagaaaataggt
ttatggacgctgcaacttgtgacaccttttcattgtcagttcctagctgtagggctagaa
aaaggcacgctaaagattttgacccttcctgattttaaaactatacgtgctacagaggga
cataagaaatctgtacagaaatgtcagtttacaccagacgggcaaaccctcatcaccagc
tctgatgatgcaacaatactgctgtggaactggcagacagaagacttcaaggtgctacaa
ggacactcggagcaagtgaaaaacttcaagctgttagacaataaaagacttctctcctgg
tcctttgacggcacggttaaggtgtgggacattaccagtggtgaagtaatgcaggacttt
gcttgtcatgacggagccgtgctttgctgtgatgtgtctcctaatggtaccatgttttct
tctacctccgctgacaagacggctaaggtctggagttttagcaaccctgtccctctttat
gtactggaaggccacaaagactgtgttcgcagctgcaggttctcatggaatagcaagttc
ctcgctactggagacgacgatggagaaataaggatttggaaggtgagcaatggcaagtta
cttaacatttgcccaaaagacgctggaaattccacagagtcgaagcatggaggctgggtg
acggaccttcacttttctcccgatagcaagattctggtctcaactggaggatacatcaag
tggtggtgtgtgaataccggagaacccttacagaccttctacacaaatggaacaaacttg
aagtcaatacatgtttcccctgactttaagacctacgtcaccattgacaatattgggata
ccttacatcttaaaaatggtggaatga

DBGET integrated database retrieval system