KEGG   Latimeria chalumnae (coelacanth): 102354990
Entry
102354990         CDS       T02913                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00220  Arginine biosynthesis
lcm00330  Arginine and proline metabolism
lcm01100  Metabolic pathways
lcm04020  Calcium signaling pathway
lcm04146  Peroxisome
lcm04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102354990 (NOS2)
   00330 Arginine and proline metabolism
    102354990 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102354990 (NOS2)
   04020 Calcium signaling pathway
    102354990 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102354990 (NOS2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102354990 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 DUF1678
Other DBs
NCBI-GeneID: 102354990
NCBI-ProteinID: XP_014346908
Ensembl: ENSLACG00000017704
LinkDB
Position
Un
AA seq 1016 aa
MYAKALVRGTRDNPVTEEELLPQAIEFINQYYKSFKEPKPEEHLVRVEGVTKEIEKSGTY
QLTYNEVVFATKQAWRNAPRCIGRIQWSNLHVFDARKCTTAKEMFEHICTHLKYATNNGN
LRSVITIFPQRTDGKHDFRLWNSQLLRYAGYQMPDGVFLGDPANAEFTELCIQLGWKPKY
GQFDVLPLILQANGQDPELFEIPPELVLEVEIEHPKYDWFKELGLKWYALPAVANMLLEV
GGLEFTACPFNGWYMSTEIGVRDFCDHQRYNVTEKIGKRMGLETHKLASLWKDQVALEMN
IAVLHSFQKKNVTIMDQHTAAESFMKHMQNEYRLRGGCPADWVWIVPPMSGSITPVFHQE
MLNYILTPFFYYQVDPSKTHTWQDEKRRPKKRQIKFKDLAKAVLFASILIRKTMGNRVKA
TVLYATETGKSETFAKKLMTIFNYAFNTKVLCMDDYDFSDLEEETLLLVVTSTFGNGDCP
GNGEKLKKYLFTKKQFNYKKLRYSVFGLGSKSYPQFCAFAHAIDQKLGQLGAVQITPTGE
GDELSGQDEPFMTWAVTVFKAACKVFEIRDQLSIQLPNLESANELWNPEKYRLVPESHQM
DLISELSGLHTKNVFAMKLKCRKNLQSPNSSRSTILVQLSCENTQNLQYLPGEHVGIFPG
NSTEEVSGLVKRIKDSPLSNQTIQLEIRSDGDHWTADKKIPACTFSQALTYFLDITTPPT
QQLLKKLAQLPIDKEDKKRLDFLSQNSDEYNKWKSFNSPTIREVLEELPSLQIPATFLMA
QLPPLKPRYYSISSSLDVAPGEIHLTIAVVNYRTRDGQGPLHHGVCSTWLNTINTNEMVP
CFVRSASGFCLPKDPSQPCILVGPGTGIAPFRSFWQQRLFDMEIRGIKTHGMTLVFGCRR
SDMDHIYKEETQEMKKKGVLKGAYTAYSREPNQQKTYVQDIISNRLSDEVFKALHHEEGH
IYVCGDVRMARDVTQTLKEIFARKLKLNSEQIEDYFSQLKNKKKYHEDIFGAVFQK
NT seq 3051 nt   +upstreamnt  +downstreamnt
atgtatgctaaagcattggtgagggggactagagataaccctgtcacagaagaagagctg
ttgccacaagctatagaattcatcaatcagtattacaagtcattcaaagaaccaaaacca
gaagagcatttagtaagagttgagggcgtgaccaaagagattgaaaaatcaggaacctac
cagctgacatataatgaagtcgtatttgcaaccaagcaagcctggagaaatgctccaaga
tgcattgggagaatccagtggtctaacttacacgtgtttgatgcccggaaatgtactaca
gctaaggagatgtttgaacacatctgcacccatttaaaatatgcaacaaacaatggaaac
ttaaggtctgtcatcactatatttccacaaagaactgatggaaagcatgattttagactg
tggaacagccaactacttcgatacgctggttaccagatgcctgatggagtcttcctggga
gacccagcaaatgctgaatttactgagttgtgcatacagctagggtggaagcccaaatac
ggacagtttgatgtacttcctttgatcctccaagcaaatggtcaagatccagaactgttt
gaaattccaccagaacttgttcttgaagtggaaatagagcatccaaagtatgactggttt
aaggaattaggcctcaagtggtacgccttgcctgctgtggccaacatgcttctagaagta
ggaggtcttgaatttacagcttgccctttcaatggctggtacatgagtactgaaataggc
gtccgagacttctgtgaccaccagcgttataacgtaacagagaaaatcggcaagagaatg
ggtctggaaacccacaaactagcctctctgtggaaggatcaagttgcactggaaatgaac
attgctgtacttcatagttttcagaaaaagaacgttactatcatggatcagcacactgct
gcggaatccttcatgaagcacatgcagaatgagtaccggctccgaggaggctgcccagct
gattgggtatggattgtgcctccaatgtccggcagcatcaccccagttttccatcaggag
atgctgaattatatcctcacgccttttttttattatcaggttgatccttcgaaaacacat
acctggcaggatgagaagcgacgacctaaaaagaggcagatcaaatttaaagatcttgca
aaggctgttttgtttgcttcaatactgataagaaagaccatgggaaacagagttaaagca
acagtattatatgcaactgaaacggggaaatcagaaacatttgcaaaaaaactgatgact
atcttcaactatgcattcaacacaaaggttttgtgtatggatgattatgacttcagtgac
ttggaggaggaaacactcctgctggtagtgacaagcacatttggaaatggagattgtcct
ggcaatggagagaaacttaagaaatatctgttcacaaaaaaacaattcaactacaaaaaa
ctcaggtattctgtttttggtcttggatctaaatcgtaccctcagttttgtgcctttgct
catgcaattgaccagaaactaggacaactcggggcagtacagattactccaactggggaa
ggagatgaactcagcggacaggatgaacccttcatgacatgggcagttactgtttttaaa
gctgcctgcaaagtgtttgagattcgtgaccagctcagtattcagttgccgaacctagaa
agcgccaatgagctctggaatccggagaaatacaggcttgtacctgaatcacaccagatg
gacctgattagtgaactttctggtttgcacacaaagaatgtttttgccatgaaattaaag
tgcagaaagaacctgcagagtccaaattcaagccgctccacaattctagttcaactttcc
tgtgagaatacacaaaacctgcagtatttgcctggcgagcatgttggtattttccctggg
aactcaacagaagaagttagtggtctggttaaaagaattaaagattcccctctgagcaat
caaactatccaactggaaatacgcagcgatggtgaccactggacagcagacaaaaaaatt
ccagcttgcacattctcgcaggccctgacttatttccttgatataacaacaccaccaact
cagcaactactaaagaaactggctcaactgcctatagacaaagaagacaaaaagagactg
gacttcctcagtcagaattctgatgagtataacaaatggaagtccttcaacagtcccact
atccgagaggttcttgaagaattaccatcccttcagatcccagccactttcctgatggct
caactccctccactgaagcctagatactactctatcagctcatctttagatgtagcacct
ggagaaatccatcttaccattgctgtggtaaactatagaaccagagatggtcaaggccct
cttcaccatggtgtttgcagtacttggctaaacacaataaataccaatgagatggtccct
tgctttgtgcgcagtgcaagtggtttctgtcttccaaaggacccgtcgcaaccttgtatt
ttagtcggcccaggcacagggattgctccattcagaagcttttggcagcaacgcttgttt
gatatggaaataagaggcataaagacacatggcatgaccttagtttttggctgccgtcgg
tctgacatggaccacatttataaagaagaaactcaagaaatgaaaaagaaaggtgttctg
aagggagcttacacagcctactctagagaacctaaccaacaaaagacttatgtgcaagat
atcatttccaacaggctttcagatgaggtttttaaagccctgcatcatgaggaaggtcat
atttatgtctgtggtgatgtcaggatggctagagatgttactcagactctaaaggaaata
tttgctaggaaactgaagctgaactctgagcagatagaagactatttctctcagcttaag
aacaagaaaaaatatcatgaagacattttcggagctgtatttcaaaaataa

DBGET integrated database retrieval system