KEGG   Latimeria chalumnae (coelacanth): 102355060
Entry
102355060         CDS       T02913                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04012  ErbB signaling pathway
lcm04068  FoxO signaling pathway
lcm04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102355060 (CDKN1B)
   04068 FoxO signaling pathway
    102355060 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102355060 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102355060
NCBI-ProteinID: XP_006004206
Ensembl: ENSLACG00000012263
UniProt: H3AWA7
LinkDB
Position
Un
AA seq 198 aa
MSNVRISNGSPSLERMEARQSDYPKPSACRNLFGPVDHEELTRDLKTQRQAMEEEFQQRW
NFDIKNHCPLEGRFQWEAVYSKDVPDFYSRPPRRPKNVCNSGNIPALDLNGNHHAMSFVG
SQGTAESRHSVDKNTETPECQTEPLDRCTGQRKRAATEDSSPQNKKANTTEGEMSEESPS
VSTVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgttcgcatttctaatggtagccccagtttggaaaggatggaagccaggcag
tctgactaccccaaaccttcagcttgcagaaacctatttgggccagtggatcatgaagag
ttaactcgggatttaaaaacacaacgacaagccatggaagaggaatttcagcaacggtgg
aatttcgatattaaaaatcactgtcccctggaagggagattccaatgggaggctgtgtac
agcaaagatgtgccagatttttactctagacctccaaggcgacccaagaacgtatgcaat
tcaggaaatatacctgctttggatctgaacgggaatcaccatgcgatgagttttgttggg
tctcagggaacggcagagagcagacattctgtagataaaaatactgaaacaccagaatgt
caaacagaacccttagatcgatgcactggtcaaaggaaaagggcagctactgaagactcg
tcaccgcaaaataagaaagccaacacaacagagggtgagatgtcagaagagtcccccagt
gttagtacagtcgagcaaacccccaagaaaagcagccccagaagacatcaaacgtaa

DBGET integrated database retrieval system