KEGG   Latimeria chalumnae (coelacanth): 102355159Help
Entry
102355159         CDS       T02913                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00250  Alanine, aspartate and glutamate metabolism
lcm00280  Valine, leucine and isoleucine degradation
lcm00410  beta-Alanine metabolism
lcm00640  Propanoate metabolism
lcm00650  Butanoate metabolism
lcm01100  Metabolic pathways
Module
lcm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102355159 (ABAT)
   00650 Butanoate metabolism
    102355159 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102355159 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102355159 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102355159 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcm01007]
    102355159 (ABAT)
Enzymes [BR:lcm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102355159 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102355159 (ABAT)
Amino acid related enzymes [BR:lcm01007]
 Aminotransferase (transaminase)
  Class III
   102355159 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Tex_N
Motif
Other DBs
NCBI-GeneID: 102355159
NCBI-ProteinID: XP_014352088
Ensembl: ENSLACG00000006158
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASSLLTRQLTYTLQKNLKLSLPRGRYISQTATKNDVDFEYDGPSMKTEVPGPRSRTLLK
QLDGIQNTGAVTFFCNYEESRGNYLVDVDGNRMLDLYCQISSIPIGYNHPALIKVLHDPT
NVSTFVNRPALGVLPPENFPEKLTESLLSITPEGMNQVQTMACGSCSNENAFKTIFIWYR
KKERGQVEITKEEQETCMINQSPGCPDYTIMSFMGGFHGRTMGCLAATHSKAIHKLDIPS
LDWPIAPFPQLKYPLEDFIKENKLEEARCLEEVEDLIVKYRKKGKTVAGIVVEPIQSEGG
DNHASDDFFRELREVVRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLKDPGDIVSFSKKLQ
TGGYFYKDEFRPDAPYRIFNTWLGDPAKNLLLAEVINVINTEKLLDNVSRAGKVLLDGLL
DLQTRYPHLVSRARGRGTFCSFDAPDDDKRNRMILKARNKGVVLGGCGEKSIRFRPALVF
KEHHAHLFLNIFNDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctctgcttacccgtcaactgacctacactctgcagaaaaacctgaagctc
tctctacctagaggcaggtacatcagtcaaactgccacaaagaatgatgtggattttgaa
tatgatggtccttcaatgaaaacagaagtccctggcccaaggtctaggacattgcttaaa
cagttggatggaatacagaatacaggtgctgtgacctttttctgcaattatgaagaaagc
cgggggaactacctagtggatgtagatggaaacagaatgttggatctttactgtcagatc
tcttcaatccctattggttataatcatcctgcactgattaaagtgctgcatgatccaact
aatgtgagtacttttgtcaacagacctgccttaggagttctacctccagaaaacttccct
gaaaagctgacagagtccttgctttcaataacaccagaggggatgaaccaggtacagacc
atggcctgtggttcctgttccaatgaaaatgctttcaaaaccatattcatatggtacaga
aaaaaagaaaggggtcaagtggagatcactaaagaagagcaggagacatgcatgattaac
cagtccccaggctgccctgattacacgattatgtccttcatgggaggattccatggaaga
accatgggttgcctagctgcaactcactcaaaggcaattcacaaactagacattccttct
cttgactggcctattgccccctttccacaactgaagtatcctctggaagattttattaaa
gagaataaactggaagaggcacgatgcttggaggaggtggaggaccttatagtaaaatac
agaaagaaggggaagactgttgctggaatagtcgttgagccgattcagtctgagggagga
gacaatcatgcttcagatgatttcttcagagaactaagggaggttgtcagaaagcatggc
tgtgcattcttagtggatgaagtccagacaggtggaggctgtactggcaagttctgggcc
catgaacactgggggttgaaggacccaggggacattgtctcttttagtaagaagttacag
actggaggctacttctacaaagatgaattcaggcccgatgctccttaccggattttcaac
acctggttaggcgaccctgccaagaatcttctgctggcagaagtaattaatgttatcaat
acagaaaaacttttggacaatgtctcaagagcaggaaaagttctacttgatggactccta
gatttacagactcgttatccacatcttgtgagcagagccagaggtcggggaacattctgt
tcatttgatgcaccagatgatgataaaaggaacagaatgattctaaaagcaagaaataaa
ggtgttgtacttggaggctgtggtgagaagtccattcggttccgccctgctctagtcttc
aaggagcaccatgcacatctattcctcaacatttttaatgacattctggcagacttcaaa
taa

DBGET integrated database retrieval system