KEGG   Latimeria chalumnae (coelacanth): 102355272Help
Entry
102355272         CDS       T02913                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00052  Galactose metabolism
lcm00500  Starch and sucrose metabolism
lcm01100  Metabolic pathways
lcm04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102355272 (GAA)
   00500 Starch and sucrose metabolism
    102355272 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102355272 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcm04147]
    102355272 (GAA)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102355272 (GAA)
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102355272 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N Trefoil
Motif
Other DBs
NCBI-GeneID: 102355272
NCBI-ProteinID: XP_014340010
Ensembl: ENSLACG00000017791
LinkDB All DBs
Position
Un
AA seq 921 aa AA seqDB search
MSTPAGSSRKERRPPVWNGRVATVLKCSIIGLLTVAVAVALYQASLSSRSTVVLRSLRSA
ESNPPVMYWSGQARGREEPKGRRDQERMSYPKLANHSSPGYCNITVDHRFDCAPDQATRE
DCENRGCCYSSTYRDSQTVPACFFPLGYPSYKMGKLSPTTTGYKAKLKRVMESFFPNDVM
TLKLEVKYETEGRLHFSVSILSAQVSALHVFPVFLSLNTTVAPLFYADQFLQISTALPSR
YISGFGEHLDRLTLDLDWTKITFWNRDGGPRPNANLYGSHPFYLAMEEDGSSHGVFLLNS
NGMDVVLQSAPALTWRTIGGILDFYVFLGPDPKSVVKQYLDVIGYPVMPPYWGLGFHLCR
WGYYSTNVTREVVRKMREAGMPQDVQWNDLDYMDEKRDFTYNEKYFGDYPEMVQEFHQLG
LKYIMILDPGISSTGLPGTYRPYDEGLERGVFIKNQTGDPLIGKVWPGQTAFPDFTNPET
HAWWYDMLEDFHRNISFDGMWIDMNEPSNFVTGSVDNCPMNDLEDPPYVPGVIGGTLRTK
TICASGEQFLSTHYNLHNLYGLTEAIASHDALIKLLKKRPFIISRSTYVSHGHYAGHWTG
DIWSSWDQLYYTIPAIIRFNMYGVPLVGADICGFGGNTTEELCIRWTQLGAFYPFMRNHN
DFYNGPQEPYVFSKEAQDCIRKAIFLRYKLLPFLYTLFHQAHSAAETVARPLFFEFPTDP
NTWTIDHQLMWGDALLITPVLKKGWLEVTGYFPSTTWYSLFDGSVIKSKGQYIILPAPLD
TINVHVRGGSIIPLQEPNMTTSASRHNPFCLIVALSEHGLARGELFWDDGDSLMTFESGD
YTHILFLAKKDVLLSEVIRVNSQIDGLILGEVTVFGVLKYPKNVYVNGVSISTFSYQPET
QVLNVKLLTLLMGEQFTIMWS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaccagcggggagcagcagaaaggagaggagacccccagtatggaacggccgt
gtggccacggtactaaaatgctccataatcggtctcctcacagttgcagttgcggttgca
ttataccaggcgtccctgtcatccagaagcactgtggttctccggtcgctgcgaagcgcc
gagtctaatcccccggttatgtattggtctgggcaggctaggggcagagaggagcctaag
ggaaggagagatcaggagagaatgagttaccccaaactcgcaaaccactccagccccggg
tattgtaacatcaccgtggaccacaggtttgactgcgcccccgaccaagccaccagggag
gattgtgaaaaccgggggtgctgctactctagcacttacagggactctcaaaccgtgccg
gcctgcttcttccctctcggctatcctagctacaagatgggcaagttgtctccgaccacc
accgggtacaaagcaaagctgaagcgggtcatggagtcctttttccccaacgacgtcatg
acgctgaagctggaggtgaagtacgagacggagggccgactgcatttttctgtaagcata
ttgtctgctcaagtttctgccttgcacgtttttcctgtttttctcagtttaaacacgacg
gtggcgcccctgttctacgcagatcagttcctgcagatctccaccgccctgccgagccgc
tacatctccggcttcggggagcacctcgacagactcaccctggacctggactggaccaag
attaccttctggaaccgtgatgggggcccacgtccgaatgctaatctgtacggctcccac
cctttctacctggcaatggaggaggacggatcttctcacggggtcttcctcttgaacagt
aacgggatggatgttgtgctgcagtcagctccagccctgacctggaggacaattggggga
atcctcgacttttacgttttcttgggtccggaccctaaaagtgtggttaagcagtacctg
gatgtgattgggtaccctgtcatgcctccatattgggggctggggttccatctctgtcgt
tggggttactacagcacaaacgtcacccgggaggtcgtgaggaagatgagggaagctggc
atgccgcaggatgtgcagtggaatgacttggattacatggatgagaaacgagacttcact
tacaatgaaaaatactttggtgattatcctgagatggtacaggagttccaccagcttggt
ttgaaatacatcatgatcctggatcccggtatcagcagtactggacttcctggcacctac
agaccatacgatgaagggttagagagaggggtattcattaaaaaccaaactggagacccc
ttgattggaaaagtttggccgggccagactgcatttcctgatttcacgaacccggagact
cacgcctggtggtatgatatgctggaggactttcacagaaacatatcctttgatggaatg
tggattgatatgaatgagccttccaacttcgtgacggggtccgtcgataactgtccaatg
aacgacctggaggacccgccctatgttccaggtgtgattggcgggacgctgcgtacaaaa
accatctgcgcatcaggggaacagtttctctccacccactacaacctccacaacctgtat
gggctgacggaggccatcgcttcgcacgatgctctgataaaactgctgaaaaaacgcccg
tttatcatctcacgctccacgtacgtgagtcacggacactatgcagggcactggactggg
gatatctggagcagctgggaccagctctactacaccatcccagcaataatacggtttaac
atgtacggcgtccctctggtgggagcagatatctgcgggtttggcggtaacactacggag
gagttgtgcatccgctggactcagctgggagccttttaccccttcatgaggaatcacaac
gacttctacaacgggccacaggagccctacgtcttcagtaaggaagctcaggattgcatc
cgaaaggccatttttctgcgctacaagcttctgccgttcctctacacgctcttccaccaa
gcacactcggccgcagagactgtagccaggcctctgttctttgagttccccactgatccg
aacacttggactatagaccatcagctaatgtggggggatgctctcctcatcactccagtg
ctgaaaaaagggtggctagaggtgactggctatttcccctctacaacatggtacagtctg
tttgatggatcagtgatcaaaagtaaaggacagtatatcatcctaccggccccgctggac
accatcaatgtgcacgtgaggggaggctctattataccactacaggagcccaacatgaca
acctcagcgtcccgtcataacccattctgcctcatcgtggcgctgtcggagcatggactc
gcccggggtgagctcttttgggatgatggggatagcctgatgacctttgaatcgggagat
tatacccacatcctcttcttagcaaaaaaggacgtgctgctgagtgaagtgatccgagtg
aacagccaaatcgacgggctgatcctgggggaggttacagtcttcggagttctcaaatac
cccaagaatgtctacgttaatggagtctccatctctaccttcagctaccagcctgaaacc
caggttctgaacgtgaagctgcttacactactaatgggagaacagttcacaatcatgtgg
tcttaa

DBGET integrated database retrieval system