KEGG   Latimeria chalumnae (coelacanth): 102355446Help
Entry
102355446         CDS       T02913                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma 3
  KO
K06247  laminin, gamma 3
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04510  Focal adhesion
lcm04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102355446 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102355446 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 102355446
NCBI-ProteinID: XP_005990693
Ensembl: ENSLACG00000016542
LinkDB All DBs
Position
Un
AA seq 1581 aa AA seqDB search
MKQAVWIYNFFCFLSSFFPLVFAGMDSCYDDAGRAQRCMPEFENAAFNKSVMVTNTCGSP
AERYCLQTGVTGMAALCHQCDSGDPALHHNATYLTDFHNTEEPTWWQSQSMVFGIQYPNS
VNLTLHLGKAYEITYVRLKFFTSRPESFAIYKRTRINGPWIPYQFYSASCHKSYGRRERD
YLRPGDSEQVAFCTDEFSDISPLMGGNVAFSTLEGRPSAYNFDGSPSLQEWVTATDILIS
LNRLNTFGDDIFKDQKVLQSYYYAISDFSVGGRCKCNGHASECVINEVGRLVCNCQHNTT
GVDCEKCWPSYHDRPWARATAQATNECLPCNCNGRSEACIFDAELYRSTGHGGHCLNCRG
DTDGPRCERCRQNFYRSDPQYDCRPCGCDLKGSLSLQCDGEGTCTCKPSVMGQKCDRCHH
GYHSLTEAGCSPCACDPAGSIGICNSENGQCTCKENVEGHLCHRCKPGAFNLQPHTPAGC
TSCFCYGHSAACFAAMHYAVHHIRSNFTRDTDGWRGQYLDGREFSLQWMEGELHLPMNNE
EWVYFIAPVKFLGNQLLSYRQNLTITFRVENKEFFPLSLQLLLEGPGRRASILLSLQTER
EKGDGEWTFTFRLHESEAGLQTPLTAFQFHQLLSNLTAIRITAIGGPQYTVSLREVALVS
ARPGLSPPAYWVEECVCPQGYISQFCEICSPGYKRETPSGGPFVPCVPCTCNQHGTCNPE
TGMCQCLHNTAGPMCELCADGFYGNSFVGRTDDCKPCPCPGQSACALVPNSTEVVCTECP
TGQTGRRCELCDNGFYGDPLGWDGPARPCTLCQCNGNTRQSADCDHRTGMCRDCIYNTAG
DHCDMCKEGYYGNALALNPLHKCNPCSCSLTGSARQQQTCHSETGQCECLPNVIGQQCNQ
CKPGFFNLVPVYGCERCDCHPIGSENSFCHPIMGQCPCHPGVEGMACDKCQPGFFSFSSK
GCRACSCSLLGSLSLQCQEDGTCVCKKGFVGSKCDQCEVNYYHSATTSTCEECPVCYSLV
RDQADKLKAKLWVMEELLKKPRYQNYRDHKSNSSQRDQPHSDRILEAPTLLDIRDIFLDQ
ILELEASTQTVLSQLRNFSGFWSCENSANGKLCSLLSDSIFSFRQTRKELHAARSTLSTM
VIPEEISSKPTKWNSLVNESQALANSQGEAAAQIELIARNALLASNISYTLLSNILEEES
SREFVEELEEQFQQMQEAKESLSHKIDETVTKAKKSYKSSERSMTVLATALSNLTNSQEK
MLPVANLSGEVEASEKLLRSKAELLEESMERLRPELETAKKGMEAQQEAEKLMTCANVSY
DVATSSVATAKETAAEAKALLKALQGTQRSFVQREPQTKAALEKVGAIQGKQIAYTLKKT
QQAEKMLGAAANLTSWKRTATGANRAADKTSKEVKEILGEAKNAHKMASNLNQDVSSALE
EMMTQSVKAEELKREIEELDEASADIDKMDKKIRKARISLESDVKKLSKLLKRLEDLQLN
GGAESALNETEAQLEVLRQNLHKASLEKKMRALQEAAEQQQSKMREFAKEIAEIEVDKHN
LEDVIQSLPQGCFNRLGSTKN
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcagtgtggatttataactttttttgctttctctccagcttcttccccctg
gttttcgcagggatggactcctgctatgatgatgcaggaagggcccagaggtgcatgccg
gagttcgagaatgctgccttcaacaaaagcgtgatggtgaccaacacctgcggctcccct
gccgaaaggtactgccttcagaccggggtgacggggatggcagcgctgtgccaccagtgt
gacagcggggaccctgccctccaccacaatgccacctatcttaccgacttccacaatact
gaggagccaacttggtggcaaagccagtccatggtgtttggtatccagtaccccaactct
gtcaacttgacgttacacctagggaaagcctatgaaatcacctatgtgcggctcaagttt
ttcaccagtcggccagagagctttgccatttacaagcggacccgtataaatgggccgtgg
atcccataccagttctacagtgcctcctgccacaaaagctatgggagacgtgaacgggac
tacctgcggcctggggacagcgagcaggtggcgttctgcacagatgagttcagtgacatc
tcgccgctgatgggagggaacgtggctttctccacattagaggggcgacccagtgcttat
aactttgatggaagcccgtcgcttcaggagtgggtgactgccacagacatcctgatttcc
ttgaaccgactcaacacttttggggatgacatcttcaaagatcagaaagttcttcaatcg
tactactatgctatctcagacttttccgttggaggcaggtgtaagtgcaatggacacgcc
agcgagtgtgtgatcaacgaggtggggcgtctggtctgtaactgccaacacaataccacc
ggcgtggactgtgagaagtgctggccatcctaccacgatcgcccctgggctagagccacg
gctcaggccaccaatgagtgcctcccatgtaactgcaacgggcggtctgaggcgtgcatc
tttgatgctgaactgtaccggagcacaggccatggtgggcactgcctgaactgccgaggc
gacactgacgggccgcgctgtgagcgatgccgccagaacttttaccggagtgatccgcag
tacgactgcaggccctgtggctgtgacctaaagggttcgctcagtttgcagtgtgacggt
gagggcacctgtacttgcaagcccagtgtaatggggcagaaatgtgaccgttgtcaccat
ggttaccactcactcactgaggctggctgcagtccgtgtgcgtgtgacccggcaggcagc
atcgggatctgtaattcagagaatggacagtgcacctgcaaggagaatgtggaaggacac
ctgtgtcacagatgcaagcctggtgcatttaacctgcagccccacacccctgcaggctgc
accagctgtttctgctatggccactccgccgcatgctttgcggcgatgcactacgccgtg
catcacatcaggtccaacttcacacgagacacggatggctggagaggacagtacttggat
ggaagggagttctcactgcagtggatggaaggggagctccacctacccatgaataatgag
gaatgggtttacttcatagcaccagtgaagtttttggggaatcagctgctgagttacaga
cagaacctcaccataacattccgagtggaaaacaaggaattcttcccattgtccctgcag
ctgcttctggaaggaccaggaaggagggcttcaatccttctctctctgcaaactgaaaga
gagaagggtgatggagaatggactttcactttcagactgcatgaaagtgaggctgggctc
caaacgccactcacagctttccagttccaccagctgctctccaacctcaccgctatcaga
atcactgccatagggggtccacaatatacagtgtctctgcgagaggttgccctggtctct
gctcgcccgggtctctctccacctgcctattgggtggaggaatgcgtgtgccctcagggt
tacatcagccaattctgtgagatctgttctcctggatacaagcgggagactccatctgga
ggaccattcgtcccatgcgtgccctgtacctgcaatcagcatggaacctgcaacccggag
actggtatgtgccagtgccttcataatactgctggccccatgtgtgagctctgtgcggat
ggtttctatggcaactcatttgttggaaggacggatgactgtaaaccgtgtccttgtcct
ggtcagtctgcatgtgctctggtccccaacagcacagaggtggtctgtaccgagtgccct
acagggcaaacaggcaggcggtgtgagctatgtgataatggcttttatggagacccgctg
ggatgggatggccccgcccgcccctgcaccctgtgccagtgtaatgggaacacgaggcag
agtgcagattgtgatcatcggacgggtatgtgccgggattgcatctacaatacggcagga
gatcactgcgacatgtgtaaggaaggttactatgggaacgcactggcacttaacccactt
cacaagtgcaacccatgtagctgtagcctgactggttctgctcgtcaacagcagacttgc
cattctgagactggccaatgtgaatgtctgcctaatgtgattggccagcaatgtaaccag
tgcaagcctggctttttcaacctggtacccgtgtatggctgtgagagatgtgactgccat
cccattggttctgagaacagcttctgccacccaatcatgggccagtgtccctgtcaccca
ggagtagaggggatggcatgtgataagtgccagcccggtttcttcagtttctcatccaag
ggctgccgagcttgtagctgctccctgctgggttctctgagcctgcagtgtcaagaggac
gggacgtgtgtttgtaagaaaggcttcgtgggatccaagtgtgatcagtgtgaagtgaat
tactaccacagtgccaccacctccacttgtgaggagtgtcctgtctgctacagcctggtg
cgggaccaggctgataagttgaaggcaaaactttgggtgatggaggaacttttgaagaag
ccaaggtatcagaactacagagaccacaagagtaactccagccagcgggatcagccacac
tcggacagaatcttggaagcaccgacccttctcgatattcgggacattttcttggatcag
attttggagctggaggcctcaacgcagactgtcctgtcccagttgaggaacttcagcggg
ttctggagctgtgagaacagtgccaatgggaaactctgcagcttgttgtcggacagcatt
ttctcctttaggcagacaaggaaggagcttcatgcagccaggagcacgctcagtaccatg
gtgattcctgaggagatttccagcaagcctaccaagtggaacagtctggtgaatgaatcc
caagccctggctaatagtcagggtgaagctgcagcccagattgagctcattgcccgaaac
gctcttctagcttccaacatctcctacactttactgtccaacatcttggaagaagaatct
agcagggagtttgtggaagagctggaggaacagtttcaacagatgcaggaagctaaagaa
agcctaagccacaaaatagatgagaccgtgacaaaagccaaaaagtcctataaatctagt
gaacgaagcatgactgtgctggccacagccctttctaatctcaccaattcacaagaaaag
atgcttccagtggccaatctgagtggtgaggtagaggcttctgaaaagctattgcggtct
aaagcggagctgctggaggagagtatggagcggctgcggcctgagctggagacagcgaag
aaggggatggaagctcagcaggaggcagagaagctgatgacatgtgcaaatgtatcgtat
gatgtggccacctcgtcagtcgcaactgccaaggaaactgcagctgaagcaaaggccctt
cttaaagcactgcaagggacgcagaggtcctttgtccagcgggaaccccagactaaagcc
gctcttgaaaaggtgggggccattcaagggaagcagattgcatacactctgaaaaagacg
cagcaggctgagaagatgctgggagctgctgctaacttgacctcatggaagaggacagct
actggggcaaacagggctgccgacaaaacctcaaaggaagtgaaagaaatcctgggagaa
gctaagaatgctcacaaaatggcctccaacctgaaccaggatgtaagttcagctctggaa
gagatgatgacccagagtgtaaaagcagaagaactgaagagagagattgaggagctcgat
gaggcatcagcggacattgacaagatggacaagaagatacgaaaggcgagaatttccttg
gagagcgacgtgaagaagctcagcaagctgctgaaaagactagaggacctgcagctgaat
ggaggagcagagagcgccctgaatgaaaccgaggcccagctggaggtgctgcggcagaac
ctgcacaaggccagcctggagaagaagatgcgtgcactgcaagaggcagcagagcagcag
caaagcaagatgcgcgagtttgcaaaggagattgcagagatagaggtggacaagcataac
ctggaggacgtcatacagagcctaccccagggctgcttcaacagactggggagcaccaaa
aactga

DBGET integrated database retrieval system