KEGG   Latimeria chalumnae (coelacanth): 102355447Help
Entry
102355447         CDS       T02913                                 

Definition
(RefSeq) beta-Ala-His dipeptidase-like
  KO
K05604  beta-Ala-His dipeptidase [EC:3.4.13.20]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00330  Arginine and proline metabolism
lcm00340  Histidine metabolism
lcm00410  beta-Alanine metabolism
lcm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102355447
   00340 Histidine metabolism
    102355447
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102355447
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcm01002]
    102355447
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.20  beta-Ala-His dipeptidase
     102355447
Peptidases [BR:lcm01002]
 Metallo Peptidases
  Family M20
   102355447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-GeneID: 102355447
NCBI-ProteinID: XP_005990781
Ensembl: ENSLACG00000017272
UniProt: H3BCM1
LinkDB All DBs
Position
Un
AA seq 490 aa AA seqDB search
MIQLALVSFLLLFGTEAVPSHLNQVLKHIEDHQDEYVQVLKEWIAVQSDSNDVLKRDDLL
RMMEITASKITDVGGTAELVNVGDQKLPNGETIPLPPVVLGEVGKDPLKPTVCIYGHVDV
QPAKKEDGWDTDPYVLTEINGNLYGRGASDNKAPVLAWINAVSAFQALEIDIPVNVKFFI
EGMEETGSPALDELIQNRNDTFFTSIDYIVISDCSWLSKKPALTYGTRGNCYFFAEVECA
KQDLHSGVFGGSVHEAMSDLIALLDSLSDSSGKILVPGISDAVAPLTDEEEKLYEGIEFN
LEHFKNEVGTTGLRHNSVEGTLLHRWRYPSLSIHGIEGAFSEPGTKTVIPAKVIGKFSIR
QVPNMDPQVVKKQVTEYLQTVFTARNTPNKLKVTMVIGVKPWLANVNNSHYIAGRRAVER
VFGVKPDMIREGGTIPIARILQEVLQKSIMMLPIGGADDGIHSQNEKISRYNFIEGTKLF
AAYFQEIAQL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgattcagctggcgcttgtgagttttttgctactgtttggtacagaagccgttccttcc
cacctgaatcaggtgttaaaacacattgaagaccaccaggacgagtatgtgcaggtatta
aaggaatggatagcagtccagagcgactccaatgatgtgctgaagagggatgatctgcta
cgcatgatggaaataacagcttcaaagatcacagatgtagggggaacagcagaattggtg
aatgtaggagatcagaagctacctaacggagagacgattcccttgccaccagtagttctg
ggtgaagttggaaaggatcctttgaagcctacagtttgtatatatgggcatgtggatgta
cagcctgcaaaaaaagaagatgggtgggatacagacccctatgtactaacagagataaat
ggtaatctgtatggacgaggagcttcagataacaaagcacctgtcttagcctggataaat
gcagtttcagcatttcaagctctggaaatagacattcctgtgaatgtcaagtttttcatt
gagggcatggaagaaactggatcccctgcactggatgaactgatacagaatagaaatgac
actttttttaccagtattgactatattgtcatatcagactgttcgtggctcagcaagaag
ccggccctcacttatgggacgagaggaaactgctacttctttgcagaggttgaatgtgct
aagcaggatttacactctggggtctttggtggctcggttcatgaagcaatgagtgacttg
attgcacttctagacagcctttcagattcctccggtaagatcttggtacctggcatcagt
gatgctgtagctcctctcacagatgaagaggaaaagttgtatgagggaattgagtttaat
ctggaacatttcaagaatgaagttggtacaacaggacttcgacacaactctgtggaaggc
actcttcttcacagatggcgctacccatcactttccatccatggaatcgaaggagctttc
tctgaaccagggaccaaaactgtcatccctgctaaagtaattggtaaattttccatccgc
caggttccgaacatggatccccaggtggtgaaaaaacaggtaacagagtacctgcagaca
gtgtttactgcaagaaatactccaaacaagttgaaagtaaccatggttatcggcgttaaa
ccttggctggctaatgttaacaattctcactacatagctggaagaagagctgttgagaga
gtttttggagtaaagcctgacatgatccgtgaaggaggaacaattccaatagcaagaata
ctgcaagaagttttacaaaaaagtattatgatgctgccaattggaggtgccgatgatggg
atacattctcaaaatgagaaaatcagcaggtataactttattgaagggaccaaactgttt
gcggcgtacttccaagaaattgctcaactataa

DBGET integrated database retrieval system