KEGG   Latimeria chalumnae (coelacanth): 102356233
Entry
102356233         CDS       T02913                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04010  MAPK signaling pathway
lcm04060  Cytokine-cytokine receptor interaction
lcm04068  FoxO signaling pathway
lcm04144  Endocytosis
lcm04218  Cellular senescence
lcm04350  TGF-beta signaling pathway
lcm04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102356233
   04350 TGF-beta signaling pathway
    102356233
   04068 FoxO signaling pathway
    102356233
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102356233
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102356233
  09143 Cell growth and death
   04218 Cellular senescence
    102356233
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102356233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102356233
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102356233
Protein kinases [BR:lcm01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102356233
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 102356233
NCBI-ProteinID: XP_006004370
Ensembl: ENSLACG00000010067
UniProt: M3XIM2
LinkDB
Position
Un
AA seq 574 aa
MGRRWLLGITSLLLLSAALCSLAFTNLTTNLCKWCDESHPTCENNVCKSNCNFSSFCETA
EEICVTIWKEVNGSTSVRTLCHHPRVLVENVFVPHYNTNECLMTKQSTEEGLLYICGCVE
EHECNDKIIFEPERNGSTILQSKEVIPVALLSLLPPLLVAVMVTMAVYFYRTRQQRKVAK
DWSQKQVQHQPLTLPEGRKAIEYEGKLSVITDDGHSDISSTCANNINHNTELLPIDLDVV
VGKGRFAEVWRAKLKQSTSEQYETVAVKIFPCEEYSSWKNERKIFSDANLKHDSVLQFLT
AEERDTGIQKQCWLITAYHSLGNLQEYLTHQILGWTALHKMAGSLVNGVAHLHSDYTASG
APKIPVAHRDIKSTNILVKSERECVLCDFGLALRLDPSLTVDDFANSGQVGTPRYMAPEV
LESRVNLEDLESFKQMDMYSMALVLWEMASRCEAIGEVKSYELPFGSKVREHPCVESMRD
IVLRDKGRPEIPNSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLIEQMYCEDA
TNNNTETESGKGVFQSAAPGSCDGSTYPQLVTEV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgggccgccgctggttgcttggcataacatctctactattgctgtctgccgcgctttgt
tccttggcctttacaaacctgacgaccaacctgtgtaaatggtgtgatgagtcacaccca
acgtgtgaaaataacgtgtgcaaaagcaattgtaacttcagttccttctgtgaaacggct
gaggaaatctgtgtgaccatatggaaagaagtcaatggtagtaccagcgtgcgcacactc
tgccaccatccccgggtcctggtggagaacgtgttcgttcctcattacaacacgaacgag
tgtctgatgaccaagcagtccacagaagagggactattgtacatctgcggctgtgtggag
gagcacgaatgcaacgataagatcatattcgaacccgaacggaacggatcaaccatcctg
caaagcaaagaggtaatccctgtggcattgcttagcctcctgccgccccttcttgttgca
gtcatggtgacaatggcagtttacttctatcgcacccgacagcagaggaaggtagccaaa
gactggtctcagaagcaagtccagcaccaacctctgaccctgccggaaggcaggaaagcc
atagagtacgagggcaaactatcagtgataaccgatgacggccattctgacatcagctca
acgtgtgctaacaacatcaaccataacactgaactgctgcccattgacctcgacgtggtg
gtggggaaaggcaggtttgcggaagtgtggagagcaaagctgaagcagagcacctccgag
cagtacgaaaccgtggccgtcaagatcttcccatgcgaagaatattcttcttggaaaaac
gagaggaagatcttttctgacgcaaacctcaagcatgacagcgtgctccagttcctcacc
gcagaggagagagacaccggaatacagaagcagtgctggctcatcaccgcctaccacagc
ctgggcaacttgcaggaatacctgacccatcagattctgggctggacagccctacataaa
atggctggctccctagtgaatggggtggcccatctccacagtgattatacggcatccggc
gctcccaagattcctgtagctcaccgggatattaagagcactaatattctggtaaagagc
gagagggaatgtgttctgtgcgacttcggattggctttgagactggacccatctttaaca
gtggatgattttgcaaatagtgggcaggttggtacccccaggtacatggctcctgaggtt
ctagagtcacgggtgaatctggaagacctcgagtccttcaaacaaatggacatgtactca
atggccttagtgctatgggaaatggcatctcgatgtgaagctattggagaggtgaagagt
tacgagttgccctttggatccaaagttcgtgagcatccttgtgtggagagcatgagggat
attgtactgcgagacaaaggtcgtcctgagattcctaacagctggttggtacatcagggt
atgcgctttctgtgcgacaccatcacagagtgctgggaccatgaccccgaggcgcggctg
accgcgcactgcgtcgcggagcgcttcaacctaatagaacagatgtactgcgaggatgcc
accaacaacaacacagagacagaaagcggcaaaggggttttccagagtgcggctccagga
tcctgcgatgggagcacatacccccagctagtgacagaagtataa

DBGET integrated database retrieval system