KEGG   Latimeria chalumnae (coelacanth): 102356275
Entry
102356275         CDS       T02913                                 

Gene name
STEAP3
Definition
(RefSeq) STEAP3 metalloreductase
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
lcm04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102356275 (STEAP3)
   04115 p53 signaling pathway
    102356275 (STEAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lcm04131]
    102356275 (STEAP3)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     102356275 (STEAP3)
Membrane trafficking [BR:lcm04131]
 Exocytosis
  Others
   Others
    102356275 (STEAP3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct 2-Hacid_dh_C NAD_binding_2 IlvN
Other DBs
NCBI-GeneID: 102356275
NCBI-ProteinID: XP_005991123
Ensembl: ENSLACG00000017667
UniProt: H3BDY1
LinkDB
Position
Un
AA seq 488 aa
MSRNDMGRPLLGQQNGEREPVLLEPSGVLIGILGSGDFARSLASRLVFSGFRVVVGSRHP
TRNTALFPPSTEVTTQRDAASQASIIFVAVYREHYSTLCDLRDGLSGKVLVDVSNSAEIN
HRDSNAEYLASLFPECTVVKGFNVLSAWALQSGPKDGNKQVLLCSDSPEARATVAEIARK
MGFIPVDMGSLCSAQEIENVPLRLLPEWKIPVALALGLFLGFYVYNFIRDVLHPYVTQGR
NKFYKIPIELVNVTLPCVAYTLLSLVYVPGILAAFSQLRYRTKYQRFPGWLDKWLQHRKQ
IGLLSFLCAALHATYSLCLPMRRSSRYQLLNDAFKQVKAGNEDAWVEEEVWRMELYVSFG
IMALGLLSLLAVTSLPSVGNSLNWREFNFIQSKLGYAALVISTLHTLTFGWKRAFDPNRY
KFYLPPTFTIALIIPCGLLLSKLFLLLPCVNQKLMQIRKGCEKGQRWCSFPGQNQYSDAP
ASQNTSML
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtcacggaacgatatgggaaggccactgctaggtcaacaaaatggcgagcgggagcca
gttctgttagagcccagtggagttctgattggaatactcggaagtggagattttgcccgt
tccttggcgagtcgcctggtattctctgggtttcgcgtcgtggttggcagcaggcacccc
acgcgcaacaccgctttgtttcccccctcaaccgaggtgaccacgcagagagacgctgcg
agccaggcgagcatcatttttgtggcggtttaccgggaacactactccacgctctgtgac
ctccgggacggactgagtggtaaagttctagtggacgtcagcaacagcgccgaaattaac
caccgtgattccaacgcggagtatctagcctcccttttcccagaatgcactgtggtgaaa
gggtttaatgtgttatcagcttgggctttgcagtctggtcctaaggatggcaataaacag
gttcttctgtgcagtgacagtccagaagccagggccacagtcgctgaaattgcccgcaag
atgggattcatcccggtggacatgggttcgctgtgctctgctcaggagatcgagaacgtc
cctctacgcctcctcccagagtggaaaatccctgtggcgctggcactcggcctttttttg
ggcttttacgtctacaattttatcagggacgttctccacccctacgtaacccaaggccga
aacaaattttataaaatccccatcgagttggtgaacgtcactctgccgtgcgttgcgtac
actctgctttccctggtctatgtgcctggaatcctggcggccttttctcagctgcgttac
cggacgaagtatcagcgcttcccgggctggctggataagtggctacagcatagaaagcaa
attggccttttaagctttttatgtgctgccttgcatgcaacgtatagcctgtgtcttcca
atgcggagatccagtcggtaccagctactcaatgatgctttcaaacaggtcaaagctggt
aatgaagacgcctgggtggaggaagaggtctggagaatggagctgtacgtttcttttgga
ataatggctcttgggcttttatcgcttttggctgtgacctctttaccatcggtgggaaat
tccctaaactggagggagtttaattttatacagtccaaactcgggtacgcagccttagtg
ataagtactcttcacacactaacttttggatggaaaagggcctttgatccaaatcggtac
aagttttacctgcctccgaccttcacaatcgccctgatcatcccctgcggtcttctgcta
tccaaactcttcctgcttctgccgtgcgtgaaccagaaactgatgcagatccgtaagggg
tgcgaaaaggggcaaaggtggtgcagctttcctggacagaaccaatattccgatgctcca
gcttcacaaaataccagcatgctgtaa

DBGET integrated database retrieval system