KEGG   Latimeria chalumnae (coelacanth): 102356381
Entry
102356381         CDS       T02913                                 

Gene name
EI24
Definition
(RefSeq) EI24, autophagy associated transmembrane protein
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102356381 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 102356381
NCBI-ProteinID: XP_005991209
Ensembl: ENSLACG00000016527
UniProt: H3BA54
LinkDB
Position
Un
AA seq 340 aa
MADSVKTFLLDVARGIKDSILGICTISQLDARIQQKREEQRKRRANSALARRRAQSEERK
PENEPRIASRIFQCCAWNGGVFWLSLFLFYQVFIPLLQAVSAQIIGDPSLHGDVWSWLEF
ILTSIFSALWVLPLFMLSKIVNAIWFQGIADLAFEVSGKKPQPFSSFSKIIADMLFNLLL
QALFLIQGMIVSMFPIDIIGHLIYLIHMALLYSLYCFEYRWFNNGIEMHQRLSNIERNWP
YYFGFGLPLALLTSMPSSYIIGGCLFSIFFPLFIISANEAQTPHKQYIFQLRLFSLVVFL
SNKLFHKTVYLQSSKTASSSTEKFPSPHPSPSKQRVALGQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcggacagtgtcaaaacgtttcttctggatgttgctagggggataaaagattctatt
ttggggatctgcacaatttcccagttagatgctcgaattcagcaaaaaagggaggaacag
aggaaaaggcgagcaaacagtgctctggcgcggcgaagagctcagagcgaggagagaaag
ccagagaatgagccccgaattgccagcaggatttttcagtgttgtgcatggaacggtgga
gtgttttggctaagtctctttctgttttaccaagtgtttatacctctacttcaggcagtc
tctgctcaaataatcggtgacccttcattacacggtgatgtttggtcctggttagagttt
attctcacatccattttcagtgcattgtgggtacttcccttattcatgctgagtaaaatc
gttaatgccatttggtttcagggtattgcagatttggcgtttgaggtatctgggaagaag
ccccagcccttttcaagcttcagtaagatcattgctgacatgctgtttaaccttctgctg
caggcactcttcctgattcagggtatgatagtcagtatgtttcctattgatatcattggc
cacttgatctatttaatccacatggcactactttactccctctattgctttgagtatcga
tggtttaacaatggaattgagatgcatcaacgactctccaacattgaaagaaactggccc
tattattttggatttggactgccattggcccttctcacctctatgccatcctcttacatc
atcgggggctgtctgttttctattttctttccactcttcattatcagtgctaatgaagcc
cagactcctcacaaacagtacatctttcagctgcgtctcttctccctggtggtttttctt
agtaacaaactttttcacaagacggtttatcttcagtcctccaagacagcgtcgtcctct
acagagaagtttccctcccctcacccatccccctccaaacagagagttgcattaggacag
tag

KEGG   Latimeria chalumnae (coelacanth): 102361889
Entry
102361889         CDS       T02913                                 

Gene name
TP53I3
Definition
(RefSeq) tumor protein p53 inducible protein 3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102361889 (TP53I3)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     102361889 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N
Other DBs
NCBI-GeneID: 102361889
NCBI-ProteinID: XP_006000097
Ensembl: ENSLACG00000013360
UniProt: H3AZV5
LinkDB
Position
Un
AA seq 334 aa
MLGVYFDEPGGPENLYIKEVTKPQPREGEVLIKIYASALNRADLLQRIGKYPPPKGVSQI
LGLEAAGVVVDFGPDCKRLWSPGDRVMTLLPGGGNAEYTTVSEDHLMPIPSDMTFHQAAA
IPEAWLTAYQLLHFVGKVQKGETVLVHAGASGVGTAVIQLSCLAGAVPIVTAGTQEKLHM
AAELGAAAGFNYKEEDFCERTLHFTQGTGVDVILDCVGASYWEKNLKCLGTDGRWIVYGT
LGGTEVHGDILGKLLFKRGSLLTSLLRSQSLEYKSELVKAFTENALPFFSQKDLVQLQPI
IDSIYPMDRIADAHRHMEMNKNIGKIVIETCPSK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgttaggagtatattttgatgagcctggaggaccagagaacctttacatcaaggaggta
accaaacctcagccaagagaaggcgaggtccttataaaaatatatgccagcgcacttaac
agagcagatttactgcagagaattgggaaataccctcccccaaaaggggtaagtcaaatt
ttgggtctggaagctgctggggttgtggtagactttggtcctgactgcaagagattatgg
tcccctggagaccgggtaatgacccttctgccagggggtgggaatgcagagtatacaacc
gtttcagaagatcacctgatgccaattccaagtgacatgacgttccaccaagcagctgcc
attcctgaggcttggctgacggcctatcagctgctacactttgtaggtaaagtgcagaaa
ggagagaccgtactcgttcatgctggagcgagcggggttggcactgcagtcattcagctg
tcttgtttggcaggagcagtccccatagttactgccggcacccaagaaaaactgcacatg
gcagcagagcttggagcagctgctggattcaactacaaggaagaggacttctgtgaaaga
acactgcacttcactcagggcactggagtggatgttattttagattgcgttggcgcctcc
tattgggaaaaaaacctgaaatgcctgggcactgatggtaggtggattgtgtatgggacg
ctgggaggcactgaggttcacggagatattcttggaaagctgctgttcaaacgaggaagc
ctgcttacaagcttactgcgatcacagagcttggagtataagagtgagttggtgaaagcc
tttacagaaaatgcactaccatttttctcacaaaaggatctagttcaacttcaacccatc
attgacagcatttaccccatggacagaattgcagatgcacatagacacatggaaatgaac
aaaaatattggaaaaattgttattgaaacatgtccttcaaaataa

DBGET integrated database retrieval system