KEGG   Latimeria chalumnae (coelacanth): 102356705Help
Entry
102356705         CDS       T02913                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00010  Glycolysis / Gluconeogenesis
lcm00030  Pentose phosphate pathway
lcm00051  Fructose and mannose metabolism
lcm00052  Galactose metabolism
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
lcm01230  Biosynthesis of amino acids
lcm03018  RNA degradation
Module
lcm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102356705 (PFKM)
   00030 Pentose phosphate pathway
    102356705 (PFKM)
   00051 Fructose and mannose metabolism
    102356705 (PFKM)
   00052 Galactose metabolism
    102356705 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102356705 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lcm01009]
    102356705 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lcm03019]
    102356705 (PFKM)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102356705 (PFKM)
Protein phosphatases and associated proteins [BR:lcm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102356705 (PFKM)
Messenger RNA biogenesis [BR:lcm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102356705 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102356705
NCBI-ProteinID: XP_014340237
Ensembl: ENSLACG00000019094
LinkDB All DBs
Position
Un
AA seq 828 aa AA seqDB search
MWAFDDLCSLLTNFSISAAVALVLYVAFSRTEKHEEDRHSTVIKMSNPSVNSHSRDANTM
GVGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVFFVSEGYQGLVDGGDNIKEATWES
VSMMLQLGGTVIGSARCQDFRTREGRMKGAYNLVKRGITNLCVIGGDGSLTGANEFRTEW
SGLLADLVKIGKITADEAKKSSHLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEVVDAI
TTTAQSHQRTFVLEVMGRHCGYLALVTALSSGADWVFIPESPPEENWEDHLCRRLSESRT
RGSRLNIIIVAEGAIDRHGKAITSDQIKDLVVKRLGFDTRITILGHVQRGGTPSAFDRVL
GSRMGVEAVMALLEATPETPACIVSLSGNQAIRLPLMECVQVTKDVTKAMTMGKFDEAIK
LRGRSFENNWNTYKSLAHSHLTITKSNLNIAILNVGAPAAGMNAAVRSAVRCGILQGHKM
FAVHDGFEGLALGQVEEIGWNGVGGWTGQGGSRLGTKRTLPGKYFEEISSTISQYNIHAL
VIIGGFEAFTGTLELMAGRSKYEELCIPVAVIPATVSNNVPGSDFSIGADTALNTITSTC
DRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLSSGADAAYIYEEPVGIHDLQLNVEHLT
EKMKTTVKRGLVLRNEKCNDNYTTDFIFNLYSEEGKGVFDCRKNVLGHMQQGGTPTPFDR
NFGTKLGTKAVLWLTGKIKECYRQGRIFANTPESACVLGMRKRLLVFQPVMELKEQTDFE
HRIPKEQWWMKLRPILKILAKYKISLDTSEVAHLEHITRKRVSTESPM
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcctttgatgacttgtgttccctcctgacaaatttctccatctcagcagctgtt
gccctggttttgtatgttgccttcagtcgtactgagaagcacgaagaggaccgccatagc
acagtgatcaaaatgtcaaatccgtcggttaacagtcacagccgtgatgccaataccatg
ggagtcggcaaagctattgctgtgcttacatctggaggagacgcacaaggtatgaacgca
gctgtccgtgctgtcgtgagggttggcatttacactggcgccaaggtgttctttgtcagt
gagggctatcagggattggtggatggaggtgacaacatcaaagaggcaacatgggagagt
gtgtctatgatgcttcagctgggtggtacagtaatcggaagtgcccgctgccaggacttc
cggacccgagagggccggatgaagggtgcctacaacttggtgaaacgtggaatcacaaac
ttgtgtgtgattggtggggacggcagcctgacaggcgcaaacgaatttcggacagaatgg
agcggtctgctggctgacttggtgaaaataggcaaaattactgcagatgaagccaagaaa
tcctctcacctgaatatagtgggaatggtcggctccattgacaatgacttctgcggtaca
gacatgaccatcgggacagactctgccctgcataggatcatggaggtggtggatgccatc
actaccacagcacagagtcaccagagaacctttgtgttggaggtgatgggtcgccactgt
ggttatttagccctggtgacggctttgtcttctggagctgattgggtcttcatcccagaa
tcccctccggaggaaaactgggaggatcacctctgtagaaggctgagtgagagcagaact
cggggctcccgcctgaatatcatcattgtggctgagggagctattgatcgacatgggaaa
gcgataacttcagaccaaatcaaagatctggttgtaaaacgcctcggctttgacacaagg
atcaccattcttggtcacgtccagcgtggcgggaccccttcggcctttgatcgtgtcctg
gggagcaggatgggtgtggaagcggtcatggctctgttagaagccactccagaaaccccg
gcctgtatagtgagtctgtccggtaaccaggccatccggctgccgctaatggaatgtgta
caagtgacgaaggatgtcacaaaggccatgactatggggaagtttgatgaagccattaag
ttaagaggacggagttttgagaacaactggaacacgtataagtccctggctcacagccac
ctaacaatcaccaagagtaacttgaacattgcgatcctgaatgtaggcgccccagcagca
gggatgaacgcagctgtgaggtcagcagtgagatgtggtatcctccagggacacaagatg
tttgcagtacatgatggtttcgagggcctggcgttgggacaggtggaagaaattggctgg
aatggagttggcggctggactgggcaaggtggctcacgacttgggactaaacgaactcta
cctggcaaatactttgaagaaatcagttcaactatcagtcaatataatatccatgcattg
gtcatcattgggggctttgaggccttcacagggaccctggagctgatggctggtcgttcc
aagtatgaggaactctgcatccctgttgctgtcatcccagcaacggtttccaataatgtt
ccggggtcggacttcagcattggagcggatacagctctcaataccatcacttcgacctgt
gaccggatcaagcagtcagcagctggtaccaaacgcagggtcttcatcatagagaccatg
ggagggtactgtggttacctagcaaccatggcaggtctgtcttctggtgccgacgctgca
tacatctatgaggagccagtcggtattcatgacctgcagttgaacgttgagcacctgaca
gagaagatgaagactacggtaaaacgaggacttgtgctcaggaatgaaaaatgcaatgat
aattacacaacagattttattttcaatttgtactcagaagaggggaaaggagtctttgac
tgtaggaaaaacgtattgggccacatgcaacagggaggcacacctactccatttgacagg
aactttggtaccaagctgggcactaaggcagtcctgtggctgactggtaaaataaaggaa
tgttaccgacagggccgtatttttgccaacactccggaatctgcctgcgtgttgggaatg
cggaagcgcctcctggtattccagcctgtgatggaacttaaggaacagacggatttcgaa
caccgcatcccaaaggagcaatggtggatgaaacttcgtccaatcctgaagattcttgcc
aaatacaagatcagcctggacacatctgaagttgctcaccttgaacacattacccgcaag
agagtgtcaacagaatcccccatgtaa

DBGET integrated database retrieval system