KEGG   Latimeria chalumnae (coelacanth): 102356779
Entry
102356779         CDS       T02913                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04080  Neuroactive ligand-receptor interaction
lcm04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102356779
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102356779
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lcm04030]
    102356779
G protein-coupled receptors [BR:lcm04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102356779
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 102356779
NCBI-ProteinID: XP_006006063
Ensembl: ENSLACG00000022486
UniProt: M3XL84
LinkDB
Position
Un
AA seq 246 aa
MSECYENVSIRLFYNISGKKLSETWGTRDVLVMVLGLSVCTICFVANLLVLLAIFINRHF
HYPIYYLLGNLAVADFFAGISYMYLMFHTGPFTKDLTVSRWLIRQGLLDTSLTASVANLL
AIAVERHQTIFTMQLHSTMTNQRVVIFIIAIWSVAIMMGLIPSLGWNCICSKDNCSHMAP
LYSRNYLIFWAVSNLVIFCIMVVAYSHIFIYVRRKTIYMSKHTRNLKHKETMINLMKTVG
IILGEY
NT seq 741 nt   +upstreamnt  +downstreamnt
atgagtgagtgttacgaaaatgtttcaattcgtttgttctacaatatcagtgggaagaag
ctcagtgaaacatgggggacaagagacgtactggtgatggtcttgggtctctcggtttgc
accatctgctttgtggctaacctgcttgtcttgttggccatcttcataaaccgtcacttc
cactacccaatctactaccttctgggcaacttggctgtagctgacttttttgcaggcatc
tcctacatgtacctgatgttccatacaggaccttttaccaaagacctcacagtgagtaga
tggttgatacgtcaaggtctactggacaccagtctcaccgcttcagtggccaacctgctg
gccattgcagtggaaaggcaccagaccatcttcacaatgcagcttcacagcacgatgacg
aatcaacgggtggtcattttcattattgccatctggagcgttgccattatgatgggcctc
atcccaagcctgggctggaactgtatttgcagcaaagataattgctcccacatggcccca
ctctacagccgcaactacctcatcttctgggctgtctccaacttggtcatattctgtatt
atggtggtggcctacagccatatctttatctacgtgaggaggaaaaccatatacatgtcc
aaacataccaggaacctgaagcacaaggagaccatgatcaatctcatgaagactgttggc
atcattctaggtgagtactga

DBGET integrated database retrieval system