KEGG   Latimeria chalumnae (coelacanth): 102356888Help
Entry
102356888         CDS       T02913                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00010  Glycolysis / Gluconeogenesis
lcm00053  Ascorbate and aldarate metabolism
lcm00071  Fatty acid degradation
lcm00260  Glycine, serine and threonine metabolism
lcm00280  Valine, leucine and isoleucine degradation
lcm00310  Lysine degradation
lcm00330  Arginine and proline metabolism
lcm00340  Histidine metabolism
lcm00380  Tryptophan metabolism
lcm00410  beta-Alanine metabolism
lcm00561  Glycerolipid metabolism
lcm00620  Pyruvate metabolism
lcm01100  Metabolic pathways
Module
lcm_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
lcm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102356888 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102356888 (ALDH7A1)
   00620 Pyruvate metabolism
    102356888 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102356888 (ALDH7A1)
   00561 Glycerolipid metabolism
    102356888 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102356888 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102356888 (ALDH7A1)
   00310 Lysine degradation
    102356888 (ALDH7A1)
   00330 Arginine and proline metabolism
    102356888 (ALDH7A1)
   00340 Histidine metabolism
    102356888 (ALDH7A1)
   00380 Tryptophan metabolism
    102356888 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102356888 (ALDH7A1)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102356888 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102356888 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102356888 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 102356888
NCBI-ProteinID: XP_014352278
LinkDB All DBs
Position
Un
AA seq 538 aa AA seqDB search
MMLRLSRNLTRHLHRKVLLLPGRLPLAAMSLLISNPQYAWLKELGLKEENDGVYNGRWGG
RGEVVTSYCPANNEPIARVRQATLQDYEETVKEAKEAWKVWADIPAPRRGEIVRQIGDAL
RKNISVLGKLVSLEMGKIYVEGVGEVQEYVDVCDYAVGLSRMIGGPVLPSERPGHALLEQ
WNPLGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTPLTSVAVTKIIAQVLEEN
NLPPAICSLTCGGADIGTAMAKDKRLDLLSFTGSTKVGKQVALLVQERFGRKLLELGGNN
AITVFEDADLNLVIPAVLFASVGTAGQRCTTTRRLLLHESIHDEIVEKLVKAYKQVRVGD
PWDSNTLYGPLHTKEAVGMYKAAVEEARKQGGTIACGGKVMDRPGNYVEPTVVTGLAHNA
SIVHTETFVPILYVLKFKSEEEAFSWNNEVDQGLSSSIFTQDLGRIFRWMGPKGSDCGIV
NVNIPTSGAEIGGAFGGEKHTGGGRESGGDSWKQYMRRSTCTINYSKDLPLAQGIKFE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgcgcctgtctcgaaacctcactcggcatctccaccgcaaagtgctgctgctt
cctggtcgcctgcctctcgcagccatgtccctgctgatcagcaacccccagtacgcctgg
ctgaaggagctggggctgaaagaggagaacgacggcgtttacaacgggcgctggggaggc
agaggcgaggttgtgacctcctactgtcctgctaacaatgaaccaattgcaagagtccga
caggcaactttgcaggactatgaagaaacagtaaaggaagcaaaagaggcctggaaagtc
tgggcagatattccagcccctagacgtggggaaatcgtgaggcaaattggagatgcatta
agaaagaatattagtgtcttgggcaaactggtttctttggagatgggcaagatttacgtt
gagggtgtaggcgaggttcaagaatacgtggatgtctgtgattatgctgttggtttgtct
cgaatgattggagggcctgtcttaccatcagaaagacctggacacgctcttctggaacag
tggaatcctttggggctggttggcatcatcactgcatttaacttccctgtcgcagtttat
ggctggaacaatgctattgctatgatctgtggaaatgtctgcctttggaaaggagcacct
acaacacctctcaccagtgttgcagtaaccaaaataattgcccaggttttagaagagaac
aacttgccgcctgctatctgttcactaacctgtggaggtgccgatattggcactgctatg
gccaaagataagaggcttgacctgctctcgttcactggcagcacgaaggtaggaaaacag
gtagcattgctggtgcaggagagatttggtcggaagttgctagaactgggtggaaacaac
gccattactgtatttgaagatgcagatctgaatttggtaatcccagctgtgttgtttgct
tctgtgggcacagcaggacagagatgtacaaccaccagacgattgttgctgcatgaaagt
attcatgatgagattgtagaaaagctagttaaagcttataagcaggttcgagttggagac
ccatgggattctaacactttgtatggacctctccatactaaggaagctgtggggatgtat
aaagctgcagtagaagaagccagaaagcaaggtggtactattgcctgtggaggaaaggtg
atggatcgtcctggaaactatgtggagccaacagtcgtgactggcctcgctcacaatgct
tccattgtgcatacagagacttttgtccccattctttatgtcctcaagttcaagtctgag
gaagaagccttttcctggaacaatgaggttgaccaaggtctctccagtagcatttttact
caggacttgggcagaatcttccgctggatgggtcctaagggctccgactgtgggatagtg
aatgtcaacattccaaccagtggtgctgagattggaggagcgtttggtggtgagaagcac
acgggagggggaagagaatctggcggtgattcttggaagcagtacatgagaaggtccact
tgcaccatcaactacagcaaagaccttcccttggctcaaggaatcaagtttgaataa

DBGET integrated database retrieval system