KEGG   Latimeria chalumnae (coelacanth): 102356973Help
Entry
102356973         CDS       T02913                                 

Gene name
ST14
Definition
(RefSeq) suppression of tumorigenicity 14
  KO
K08670  suppressor of tumorigenicity protein 14 [EC:3.4.21.109]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lcm01002]
    102356973 (ST14)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.109  matriptase
     102356973 (ST14)
Peptidases [BR:lcm01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102356973 (ST14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Ldl_recept_a SEA DUF1986 CUB_2 Trypsin_2 stn_TNFRSF12A
Motif
Other DBs
NCBI-GeneID: 102356973
NCBI-ProteinID: XP_014340396
LinkDB All DBs
Position
Un
AA seq 908 aa AA seqDB search
MTELESGLKYVPKAGDMNGFDEKLEFLPVTNPKKLEKSGRRKWYIIGGIVVAALIASLIV
GLLVWHFHSQAEKNKQLLMYMGAMRIANKAFIDQYEDPESEEFIALADSVKETSSRTYPS
SVYQIEMEKIDISIKKALFKLRNEYDAIEELASYHVESEVTDFSEGSVIAYFWSTFRAEQ
SQKETIDHAMEKFARSIEKEAKGKLPGRSMPTETEGTKDQSDLRIDAFEAIWKIAARNKR
LFPCFQGGGSSGHMTIDLKILYWLKMVLQMASCAFRLHAVQDKTQEFLSPDFPNHPYPSD
TNCHWLLRADPGHVIYLSFLSFDLEGEQDGDCKNDYVKVYDSLNPRETKAMITMCGSYPP
SKEFSLVSSGNVMLVTLDTDNAGNYPGFKAQFKQYPKTTACGGVLEGVSGTLSSPYFPAY
YPPNITCEWTILVPEQQHVKVSFSTFFLKEPNVDENICPKDYVEINNKRYCGDHFSLEVL
GKSHQMTVKFFSDGSHTDEGFSAQYMAFEPSNPCAGKYTCGNGVCIPENLQCDGWDDCGD
LSEEKGCECAEDQLRCNSGICKPKLWACDGVDDCGDNSDEQECSCADNEFRCQNGNCIPE
KNKCDRRDNCGDGSDESECPVVVPVICKDYTFMCNNGECINKKNAECDEVEDCQDGSDEE
NCDCGKRRFKASRIVGGVEAAVGEFPWQVSLHLKNQHACGASVISTNWLVSAAHCFYDGY
TNPDMWTAYLGLHSQKHHSQVTVMRRFKQIIVHNSFSISTYDNDVALLELETPITFSNLI
SPVCLPAKTHDFPAGSNTWVTGWGALKEGGSAAVVLQKAEVRIINYTICNEVMNGQVSPV
MMCAGFLKGGIDACQGDSGGPLTKFEGNQRGFLAGIVSWGEGCAQKNKPGIYTRVTKFRK
WIKDHSGV
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgactgagttagaatcgggcctgaaatacgtcccaaaggctggggatatgaatggtttt
gatgaaaagctggaatttcttcctgtgacaaaccctaagaagcttgaaaaaagtggacga
agaaaatggtatataattggtggtattgtggttgctgcattgatagcctcgttaatcgtt
ggactcctggtttggcattttcactctcaggcagagaaaaataaacaattactcatgtac
atgggagccatgcgtattgcaaacaaggcatttatagatcaatatgaagatcccgagtct
gaagagtttattgctcttgctgactctgtcaaggaaacgagttctaggacatatccatcc
agtgtttaccaaattgaaatggagaagatagatatttccatcaagaaagctttgtttaaa
cttcggaatgaatatgatgcaattgaagaacttgcttcctatcacgttgagtctgaagtt
actgatttcagtgaaggcagtgtgattgcttatttttggtcaaccttcagagctgagcag
tcacagaaggagacaattgatcacgccatggaaaagtttgctagaagcattgaaaaggag
gctaagggcaaactcccaggtcggagtatgccaacggagactgaagggaccaaagaccaa
tcagatcttcgtatcgatgcttttgaagccatttggaagatagctgccaggaataaacgc
ctattcccatgtttccagggaggaggttccagtggtcacatgaccattgacctgaaaatt
ctgtattggttgaagatggttttgcagatggcaagctgtgcgtttcgacttcatgctgta
caagacaaaactcaagagtttctatctcctgattttcctaaccacccatatccatctgat
accaattgtcattggttgctccgtgctgacccaggtcatgtgatctatctctcgtttctg
agttttgacttggagggtgagcaagatggtgattgcaagaacgattatgttaaagtttat
gattcgctgaatccacgagagaccaaagccatgataacaatgtgtggaagttatcctcct
tccaaagagtttagtctggtgtcatcgggaaatgtcatgctggttactttagacacagat
aatgcaggaaattacccaggattcaaagcacaattcaagcagtatccaaagacgacagca
tgtggtggtgttttggaaggcgtgagtggaacactatcatctccatactttcctgcatac
taccctccaaacattacttgtgaatggacaatcctggttcctgaacagcagcatgtgaag
gttagtttctctacattcttcctgaaggagcccaatgttgatgagaacatatgcccgaaa
gactatgtagagatcaataataaaaggtattgtggggaccacttctccttagaggtgctt
ggaaaatctcatcaaatgacagtgaagttcttttcagatggctctcacactgatgaaggg
ttttctgctcaatacatggcctttgagcctagcaatccttgtgctgggaagtacacatgt
ggcaatggcgtatgtattcctgaaaacctgcagtgtgatggctgggatgactgtggggat
ctgagtgaagaaaagggttgtgagtgcgcagaagatcaattgcggtgtaacagtggaatt
tgcaaacctaaactctgggcttgtgatggagttgatgactgtggagataatagtgacgaa
caggaatgcagctgtgctgataatgagtttaggtgtcaaaatggaaactgcatccctgaa
aagaacaagtgtgatcgtcgtgataactgtggagatggcagtgatgagtcggagtgtcct
gttgtagtccctgttatatgcaaagattacacatttatgtgtaacaacggagagtgtatc
aacaagaaaaatgcagaatgtgatgaagtggaggactgtcaagatggatccgatgaagaa
aactgtgactgtgggaaacggaggttcaaggcttcccggattgttggtggtgttgaagca
gcagtgggagagtttccttggcaggtcagtttacatttgaaaaatcaacacgcttgcgga
gcttcagttatctcaaccaattggctggtatcggcagcacactgcttctatgatgggtac
accaatccagacatgtggactgcataccttggtcttcacagccagaaacaccacagccaa
gtaacagtgatgcggaggttcaaacaaatcattgttcataattccttcagcatttcaacc
tatgataatgatgttgccttgttggaattggagactccgatcactttctcaaatttaatt
tctcctgtttgcttgccagccaaaacccatgatttcccagctgggtcaaacacctgggtg
acaggatggggtgccctgaaagaaggaggctctgctgctgtagttctacagaaggcggaa
gttcgaattatcaattacactatttgtaatgaggttatgaatggccaggtgagccctgtg
atgatgtgcgcaggattccttaaaggagggattgatgcctgccagggagattcaggtgga
ccgctgactaagtttgaggggaatcaaagaggctttctggctggaatagtcagctgggga
gaaggttgtgcacaaaagaataaaccaggaatctacacccgggtcaccaaattccggaaa
tggatcaaagaccactctggagtgtaa

DBGET integrated database retrieval system