KEGG   Latimeria chalumnae (coelacanth): 102357495
Entry
102357495         CDS       T02913                                 

Gene name
CHEK1
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102357495 (CHEK1)
   04115 p53 signaling pathway
    102357495 (CHEK1)
   04218 Cellular senescence
    102357495 (CHEK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102357495 (CHEK1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcm03400]
    102357495 (CHEK1)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102357495 (CHEK1)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   102357495 (CHEK1)
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102357495 (CHEK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo Baculo_VP1054
Other DBs
NCBI-GeneID: 102357495
NCBI-ProteinID: XP_005991214
Ensembl: ENSLACG00000016703
UniProt: H3BAR5
LinkDB
Position
Un
AA seq 475 aa
MAVPFVKDWDLVQTLGEGAYGEVQLAVNRQTEEAVAVKIVDMSRAADCPENIKKEICINK
MLSHDSIVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDVGMPEPAAHKFFQQLIAGVEY
LHSIGITHRDIKPENLLLDDKDNLKISDFGLATVFKHNGRERQLKKMCGTLPYVAPELLK
CKEFSAEPVDIWSCGIVLTAMLAGELPWDQPSEGCQEYSDWLAKKLYVTPWKKIDAMPLA
LLTKTLLQNPKDRITILNIKKDRWYTRSFQGVKRTRVSSGGVNDSPGPFSKHIRSDMDLS
PISSPNSDDSVRFSRSQPEPRTIFPSWDSTPSCINNLIQGISFSQPTCPDHMLLNSQLLG
TPGSSQNPWQRLVKRMTRFFTKLDASHSCSALKKVCEKMGYMWKMNCVNQVTLSTKDRRN
NQLIFKVNLLEMEEKTLMDFRLSKGDGLEFKRHFLKIKGRLIDIVSSQRLTLSAT
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctgttccctttgtaaaagattgggacttggtacagaccttgggagaaggggcgtat
ggagaagtgcagcttgctgtaaacagacagactgaggaagctgttgcagttaaaattgtt
gacatgagtcgagccgcagactgtcccgagaacattaagaaagagatctgtattaataaa
atgttaagccatgacagcattgtgaagttctatggacaccgacgggaaggcaacatccag
tacctgtttttggagtactgtagcggaggagagctttttgatagaattgagccagatgtg
ggaatgcctgaaccagcagcacataaatttttccagcaactgattgcaggagtggagtac
ctccacagtatagggataactcacagagacattaaacctgagaatctgctgctggatgac
aaagataatttgaagatctccgactttggcttagcaacggtattcaaacacaatggacgg
gagaggcagttgaaaaagatgtgtggaactctcccgtacgttgcaccagaattgctgaag
tgcaaagagttttctgctgagccagttgatatctggtcctgcggtattgtactcaccgcc
atgttagcaggggaattaccttgggaccagcccagtgagggctgtcaagaatacagtgat
tggcttgctaagaaactctacgtgacgccatggaaaaaaatagatgccatgccactagct
ctccttactaagactttgttacagaatcctaaagacagaattactatacttaatatcaaa
aaggacaggtggtataccagatcttttcaaggtgttaagagaacacgggtttcatcaggc
ggagttaacgactcacctggacccttttctaagcatatccgttctgatatggacctgtct
cctatttccagccccaacagtgatgattcggtgaggttttccagatctcagccggagcca
cggactattttcccatcgtgggacagcactccctcttgtattaataatctgatacagggg
atcagcttctcccagccgacctgccctgatcacatgcttctcaacagccagttactaggc
actccaggttcctcccagaacccttggcagcgtttggtaaaaagaatgacccggtttttt
actaaactggacgccagccactcctgctcagccctgaagaaagtatgtgagaaaatgggc
tacatgtggaaaatgaactgtgtgaaccaggtaacactgtccaccaaagacagacgcaac
aaccaacttatcttcaaagtaaacctgttggaaatggaagagaagaccctcatggacttc
cgcctctcaaagggagatggtttggagttcaagaggcatttccttaagatcaaaggcaga
ctgattgacattgtgagcagccagagactgaccctttctgccacatga

DBGET integrated database retrieval system